Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
PRRID_1627	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Keratinocytes and mouse skin	cell compartment	O15455.fasta	O15455	904	important for inflammation in the skin following injury	NA	24786223	2014	Pubchem_assay
PRRID_1627	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Keratinocytes and mouse skin	cell compartment	O15455.fasta	O15455	904	important for inflammation in the skin following injury	NA	24786223	2014	Pubchem_assay
PRRID_1628	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages, natural killer cells	cell compartment	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	MTT assay, Cell Proliferation Assay	24782650	2014	Pubchem_assay
PRRID_1628	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages, natural killer cells	cell compartment	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	MTT assay, Cell Proliferation Assay	24782650	2014	Pubchem_assay
PRRID_1629	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages, natural killer cells	cell compartment	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	MTT assay, Cell Proliferation Assay	24782650	2014	Pubchem_assay
PRRID_1629	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages, natural killer cells	cell compartment	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	MTT assay, Cell Proliferation Assay	24782650	2014	Pubchem_assay
PRRID_1632	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages, natural killer cells	cell compartment	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	whole blood assay (WBA), ELISA	24766820	2014	Pubchem_assay
PRRID_1632	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages, natural killer cells	cell compartment	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	whole blood assay (WBA), ELISA	24766820	2014	Pubchem_assay
PRRID_1633	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages, natural killer cells	cell compartment	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	whole blood assay (WBA), ELISA	24766820	2014	Pubchem_assay
PRRID_1633	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages, natural killer cells	cell compartment	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	whole blood assay (WBA), ELISA	24766820	2014	Pubchem_assay
PRRID_1635	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	pDCs	TLR7 signalling via the adaptor MYD88	Q9NYK1.fasta	Q9NYK1	1049	activation of either nuclear factor-Œ∫B (NF-Œ∫B) or IFN-regulatory factor 7 (IRF7), which are transcription factors that are responsible for stimulating the expression of pro-inflammatory cytokines and type I IFNs, respectively.	NA	24762827	2014	Pubchem_assay
PRRID_1635	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	pDCs	TLR7 signalling via the adaptor MYD88	Q9NYK1.fasta	Q9NYK1	1049	activation of either nuclear factor-Œ∫B (NF-Œ∫B) or IFN-regulatory factor 7 (IRF7), which are transcription factors that are responsible for stimulating the expression of pro-inflammatory cytokines and type I IFNs, respectively.	NA	24762827	2014	Pubchem_assay
PRRID_1636	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	monocyte/macrophages	LRR- and pyrin domain-containing 3 (NLRP3)	P58682.fasta	P58682	1032	production of IL-12 but not IFNŒ±	NA	24762827	2014	Pubchem_assay
PRRID_1636	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	monocyte/macrophages	LRR- and pyrin domain-containing 3 (NLRP3)	P58682.fasta	P58682	1032	production of IL-12 but not IFNŒ±	NA	24762827	2014	Pubchem_assay
PRRID_1638	single-stranded RNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	extracellular domains of leucine-rich repeat motifs	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	NA	24754320	2014	Pubchem_assay
PRRID_1638	single-stranded RNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	extracellular domains of leucine-rich repeat motifs	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	NA	24754320	2014	Pubchem_assay
PRRID_1640	single-stranded RNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, mast cells	extracellular domains of leucine-rich repeat motifs	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	NA	24754320	2014	Pubchem_assay
PRRID_1640	single-stranded RNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	elicit innate immune response	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, mast cells	extracellular domains of leucine-rich repeat motifs	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	NA	24754320	2014	Pubchem_assay
PRRID_1644	surfactant protein-A Click for more detail	Host (Endogenous) (others)	MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF	248	Protein	Natural	triggers immune responses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF)	O00206.fasta	O00206	839	plays a fundamental role in pathogen recognition and activation of innate immunity	NA	24754320	2014	Pubchem_assay
PRRID_1644	surfactant protein-A Click for more detail	Host (Endogenous) (others)	MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF	248	Protein	Natural	triggers immune responses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF)	O00206.fasta	O00206	839	plays a fundamental role in pathogen recognition and activation of innate immunity	NA	24754320	2014	Pubchem_assay
PRRID_1645	tacrolimus Click for more detail	NA	CC1CC(C2C(CC(C(O2)(C(=O)C(=O)N3CCCCC3C(=O)OC(C(C(CC(=O)C(C=C(C1)C)CC=C)O)C)C(=CC4CCC(C(C4)OC)O)C)O)C)OC)OC	NA	NA	Synthetic	Immuno suppressive drug	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	lIver	cell surface	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA	24820765	2014	Pubchem_assay
PRRID_1645	tacrolimus Click for more detail	NA	CC1CC(C2C(CC(C(O2)(C(=O)C(=O)N3CCCCC3C(=O)OC(C(C(CC(=O)C(C=C(C1)C)CC=C)O)C)C(=CC4CCC(C(C4)OC)O)C)O)C)OC)OC	NA	NA	Synthetic	Immuno suppressive drug	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	lIver	cell surface	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA	24820765	2014	Pubchem_assay
PRRID_1648	Tenascin C Click for more detail	Human (others)	MGAMTQLLAGVFLAFLALATEGGVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECVCDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHACHTQGRCEEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVNGQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDCSEVSPPKDLVVTEVTEETVNLAWDNEMRVTEYLVVYTPTHEGGLEMQFRVPGDQTSTIIQELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKFKSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYEISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLRRVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTEYGIGVSAVKEDKESNPATINAATELDTPKDLQVSETAETS	2201	Pattern-associated molecular patterns (PAMPs)	Natural	associated with chronic inflammatory conditions	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	fibrinogen-like domain (FBG)	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA	24823872	2014	Pubchem_assay
PRRID_1648	Tenascin C Click for more detail	Human (others)	MGAMTQLLAGVFLAFLALATEGGVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECVCDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHACHTQGRCEEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVNGQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDCSEVSPPKDLVVTEVTEETVNLAWDNEMRVTEYLVVYTPTHEGGLEMQFRVPGDQTSTIIQELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKFKSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYEISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLRRVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTEYGIGVSAVKEDKESNPATINAATELDTPKDLQVSETAETS	2201	Pattern-associated molecular patterns (PAMPs)	Natural	associated with chronic inflammatory conditions	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	fibrinogen-like domain (FBG)	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA	24823872	2014	Pubchem_assay
PRRID_1651	Tri-DAP Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)O)C(=O)O)N	NA	Peptide	Natural	activate NF-Œ∫B	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	macrophages and mesothelial cells	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q8BHB0.fasta	Q8BHB0	953	interacts with IKK to trigger the activation of NF-kB and the production of inflammatory cytokines, such as TNF-a and IL-6	ELISA	24766550	2014	Pubchem_assay
PRRID_1651	Tri-DAP Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)O)C(=O)O)N	NA	Peptide	Natural	activate NF-Œ∫B	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	macrophages and mesothelial cells	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q8BHB0.fasta	Q8BHB0	953	interacts with IKK to trigger the activation of NF-kB and the production of inflammatory cytokines, such as TNF-a and IL-6	ELISA	24766550	2014	Pubchem_assay
PRRID_1653	Triacetylated lipoproteins Click for more detail	Bacteria	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	elicit innate immune response	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, B-lymphocytes	extracellular domains of leucine-rich repeat motifs	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	NA
PRRID_1653	Triacetylated lipoproteins Click for more detail	Bacteria	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	elicit innate immune response	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, B-lymphocytes	extracellular domains of leucine-rich repeat motifs	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	NA
PRRID_1654	Triacylated lipopeptides Click for more detail	Bacteria	NA	NA	Lipopeptides	Natural	elicit innate immune response	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs and B-lymphocytes	Cell Surface (Exogenous)	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	NA	24830024	2014	NA
PRRID_1654	Triacylated lipopeptides Click for more detail	Bacteria	NA	NA	Lipopeptides	Natural	elicit innate immune response	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs and B-lymphocytes	Cell Surface (Exogenous)	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	NA	24830024	2014	NA
PRRID_1664	Unmethylated CpG DNA Click for more detail	Apoptotic cell(Bacteria)	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	ELISPOT assay, Proliferation assay	24828435	2014	Pubchem_assay
PRRID_1664	Unmethylated CpG DNA Click for more detail	Apoptotic cell(Bacteria)	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	ELISPOT assay, Proliferation assay	24828435	2014	Pubchem_assay
PRRID_1668	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	cell compartment	Q9NR96.fasta	Q9NR96	1032	Possible effect in case of stroke i.e it is Involved in preconditioning and No protection after gene knockout following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1668	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	cell compartment	Q9NR96.fasta	Q9NR96	1032	Possible effect in case of stroke i.e it is Involved in preconditioning and No protection after gene knockout following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1672	Uric acid Click for more detail	Host (Endogenous) (others)	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Uric acid is a product of the metabolic breakdown of purine nucleotides, and it is a normal component of urine	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Keratinocytes and mouse skin	cell surface	O00206.fasta	O00206	839	play a role in UVB induced immune suppression	NA	24786223	2014	Pubchem_assay
PRRID_1672	Uric acid Click for more detail	Host (Endogenous) (others)	C12=C(NC(=O)N1)NC(=O)NC2=O	NA	Damage-associated molecular patterns (DAMPs)	Natural	Uric acid is a product of the metabolic breakdown of purine nucleotides, and it is a normal component of urine	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Keratinocytes and mouse skin	cell surface	O00206.fasta	O00206	839	play a role in UVB induced immune suppression	NA	24786223	2014	Pubchem_assay
PRRID_1675	VTX-2337 Click for more detail	mimics viral single-stranded ribonucleic acid (ssRNA) (virus)	CCCN(CCC)C(=O)C1=CC2=C(C=C(C=C2)C3=CC=C(C=C3)C(=O)N4CCCC4)N=C(C1)N	NA	Pattern-associated molecular patterns (PAMPs)	Natural	stimulates TLR8	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	TLR8 is expressed on mDCs, monocytes, and NK cells in humans	cell compartment	Q9NR97.fasta	Q9NR97	1041	TLR8 is expected to stimulate the release of distinct inflammatory mediators, including Th1- polarizing cytokines, chemokines, and other acute phase proteins	NA	24807889	2014	Pubchem_assay
PRRID_1675	VTX-2337 Click for more detail	mimics viral single-stranded ribonucleic acid (ssRNA) (virus)	CCCN(CCC)C(=O)C1=CC2=C(C=C(C=C2)C3=CC=C(C=C3)C(=O)N4CCCC4)N=C(C1)N	NA	Pattern-associated molecular patterns (PAMPs)	Natural	stimulates TLR8	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	TLR8 is expressed on mDCs, monocytes, and NK cells in humans	cell compartment	Q9NR97.fasta	Q9NR97	1041	TLR8 is expected to stimulate the release of distinct inflammatory mediators, including Th1- polarizing cytokines, chemokines, and other acute phase proteins	NA	24807889	2014	Pubchem_assay
PRRID_1676	Zymosan Click for more detail	S. cerevisiae (Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	activates macrophages via TLR2.	Toll-like receptor 2 (TLR2)/Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	Cell Surface (Exogenous)	NA	NA	NA	TLR2 cooperates with TLR6 and CD14 in response to zymosan	NA	24830024	2014	NA
PRRID_1676	Zymosan Click for more detail	S. cerevisiae (Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	activates macrophages via TLR2.	Toll-like receptor 2 (TLR2)/Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	Cell Surface (Exogenous)	NA	NA	NA	TLR2 cooperates with TLR6 and CD14 in response to zymosan	NA	24830024	2014	NA
PRRID_1678	Zymosan Click for more detail	S. cerevisiae (Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	mast cells	cell surface	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	Real-time PCR	24818634	2014	Pubchem_assay
PRRID_1678	Zymosan Click for more detail	S. cerevisiae (Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	mast cells	cell surface	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	Real-time PCR	24818634	2014	Pubchem_assay
PRRID_1680	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	cell surface	O60603.fasta	O60603	784	Possible effect in case of stroke i.e Up-regulation of TLR2 mRNA correlates with severity of ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1680	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	cell surface	O60603.fasta	O60603	784	Possible effect in case of stroke i.e Up-regulation of TLR2 mRNA correlates with severity of ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1682	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	human MSCs (hMSCs) and murine MSCs (mMSCs)	cell surface	O60603.fasta	O60603	784	TLR2 cooperates with TLR6 and CD14 in response to zymosan	NA	24780395	2014	Pubchem_assay
PRRID_1682	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	human MSCs (hMSCs) and murine MSCs (mMSCs)	cell surface	O60603.fasta	O60603	784	TLR2 cooperates with TLR6 and CD14 in response to zymosan	NA	24780395	2014	Pubchem_assay
PRRID_1684	Zymosan Click for more detail	Fungi(Yeast)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domain with leucine-rich repeats and a conservative intracellular Toll/IL- 1 receptor (TIR) domain	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	ELISA	24757287	2014	Pubchem_assay
PRRID_1684	Zymosan Click for more detail	Fungi(Yeast)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domain with leucine-rich repeats and a conservative intracellular Toll/IL- 1 receptor (TIR) domain	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	ELISA	24757287	2014	Pubchem_assay
PRRID_1686	Zymosan Click for more detail	Fungi(Yeast)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domains of leucine-rich repeat motifs	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	Pubchem_assay
PRRID_1686	Zymosan Click for more detail	Fungi(Yeast)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	induction of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domains of leucine-rich repeat motifs	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	Pubchem_assay
PRRID_1697	leukemic Jurkat T cells Click for more detail	NA	NA	NA	Glycoprotein	Natural	NA	C-reactive protein	NA	Human	NA	NA	P02741.fasta	P02741	224	NA	NA	25917100	2015	Pubchem_assay
PRRID_1697	leukemic Jurkat T cells Click for more detail	NA	NA	NA	Glycoprotein	Natural	NA	C-reactive protein	NA	Human	NA	NA	P02741.fasta	P02741	224	NA	NA	25917100	2015	Pubchem_assay
PRRID_1703	Surface Layer Proteins (SLPs) Click for more detail	Clostridium difficile(Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Protein	Natural	The binding induces the production of IL-23 via MyD-88 signalling pathway.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Dendritic cells	LRR	O00206.fasta	O00206	839	It has the role in the inflammation.	ELISA	25626905	2015	Pubchem_assay
PRRID_1703	Surface Layer Proteins (SLPs) Click for more detail	Clostridium difficile(Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Protein	Natural	The binding induces the production of IL-23 via MyD-88 signalling pathway.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Dendritic cells	LRR	O00206.fasta	O00206	839	It has the role in the inflammation.	ELISA	25626905	2015	Pubchem_assay
PRRID_1704	NS1 protein Click for more detail	Dengue virus(virus)	DMGYWIESEKNETWKLARASFIEVKTCIWPKSHTLWSNGVLESEMIIPKIYGGPISQHNYRPGYFTQTAGPWHLGKLELDFDLCEGTTVVVDEHCGNRGPSLRTTTVTGKIIHEWCCRSCTLPPLRFKGEDGCWYGM	137	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	NA	NA	O00206.fasta	O00206	839	NA	NA	27293318	2016	Pubchem_assay
PRRID_1704	NS1 protein Click for more detail	Dengue virus(virus)	DMGYWIESEKNETWKLARASFIEVKTCIWPKSHTLWSNGVLESEMIIPKIYGGPISQHNYRPGYFTQTAGPWHLGKLELDFDLCEGTTVVVDEHCGNRGPSLRTTTVTGKIIHEWCCRSCTLPPLRFKGEDGCWYGM	137	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	NA	NA	O00206.fasta	O00206	839	NA	NA	27293318	2016	Pubchem_assay
PRRID_1742	Fucose Click for more detail	HIV-1 (virus)	CC(C(C(C(C=O)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	DCIR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Inhibition of APC functions such as cytokine production	NA	27999992	2016	NA
PRRID_1742	Fucose Click for more detail	HIV-1 (virus)	CC(C(C(C(C=O)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	DCIR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Inhibition of APC functions such as cytokine production	NA	27999992	2016	NA
PRRID_1743	Fucose Click for more detail	S. pneumoniae, K. pneumoniae, C. albicans, P.carinii, HIV-1, Dengue virus	CC(C(C(C(C=O)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	MMR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Pathogen recognition; Antigen uptake; Cell adhesion; Phagocytosis	NA	27999992	2016	NA
PRRID_1743	Fucose Click for more detail	S. pneumoniae, K. pneumoniae, C. albicans, P.carinii, HIV-1, Dengue virus	CC(C(C(C(C=O)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	MMR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Pathogen recognition; Antigen uptake; Cell adhesion; Phagocytosis	NA	27999992	2016	NA
PRRID_1748	GroEL Click for more detail	Pseudomonas aeruginosa (Bacteria)	DPTKVTRTALQNAASIAGLMITTEAMVAEAPKKDEPAMPPGGGMGGMGGMDF	52	Glycoprotein	Natural	Bacterial infection and immunostimulant	PTX3	Peptidoglycan Recognition Receptor (PGRPs)	Human	Monocytes	NA	P26022.fasta	P26022	381	NA	NA	28031262	2016	Pubchem_assay
PRRID_1748	GroEL Click for more detail	Pseudomonas aeruginosa (Bacteria)	DPTKVTRTALQNAASIAGLMITTEAMVAEAPKKDEPAMPPGGGMGGMGGMDF	52	Glycoprotein	Natural	Bacterial infection and immunostimulant	PTX3	Peptidoglycan Recognition Receptor (PGRPs)	Human	Monocytes	NA	P26022.fasta	P26022	381	NA	NA	28031262	2016	Pubchem_assay
PRRID_1752	High-mannose and fucose glycans Click for more detail	Mycobacterium spp., H. pylori, Lactobacillus spp., Leishmania spp., HIV-1, Dengue virus, Measles vir	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	DC-SIGN	C type Lectin (CTL/CLR)	Human	NA	NA	Q9H2X3.fasta	Q9H2X3	399	Pathogen recognition; Antigen uptake; APC/T cell interactions; Cell migration	NA	27999992	2016	Pubchem_assay
PRRID_1752	High-mannose and fucose glycans Click for more detail	Mycobacterium spp., H. pylori, Lactobacillus spp., Leishmania spp., HIV-1, Dengue virus, Measles vir	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	DC-SIGN	C type Lectin (CTL/CLR)	Human	NA	NA	Q9H2X3.fasta	Q9H2X3	399	Pathogen recognition; Antigen uptake; APC/T cell interactions; Cell migration	NA	27999992	2016	Pubchem_assay
PRRID_1753	High-mannose glycans Click for more detail	M. tuberculosis, S. enterica, S. mansoni, C. albicans, A. fumigatus, Malassezia spp.(Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Dectin-2	C type Lectin (CTL/CLR)	Human	NA	NA	Q6EIG7.fasta	Q6EIG7	209	Pathogen recognition; antigen uptake	NA	27999992	2016	Pubchem_assay
PRRID_1753	High-mannose glycans Click for more detail	M. tuberculosis, S. enterica, S. mansoni, C. albicans, A. fumigatus, Malassezia spp.(Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Dectin-2	C type Lectin (CTL/CLR)	Human	NA	NA	Q6EIG7.fasta	Q6EIG7	209	Pathogen recognition; antigen uptake	NA	27999992	2016	Pubchem_assay
PRRID_1756	Lewis antigens Click for more detail	Mycobacterium spp., H. pylori, Lactobacillus spp., Leishmania spp., HIV-1, Dengue virus, Measles vir	CC1C(C(C(C(O1)OC2C(C(OC(C2OC3C(C(C(C(O3)CO)O)O)O)CO)O)NC(=O)C)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	DC-SIGN	C type Lectin (CTL/CLR)	Human	NA	NA	Q9H2X3.fasta	Q9H2X3	399	Pathogen recognition; Antigen uptake; APC/T cell interactions; Cell migration	NA	27999992	2016	Pubchem_assay
PRRID_1756	Lewis antigens Click for more detail	Mycobacterium spp., H. pylori, Lactobacillus spp., Leishmania spp., HIV-1, Dengue virus, Measles vir	CC1C(C(C(C(O1)OC2C(C(OC(C2OC3C(C(C(C(O3)CO)O)O)O)CO)O)NC(=O)C)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	DC-SIGN	C type Lectin (CTL/CLR)	Human	NA	NA	Q9H2X3.fasta	Q9H2X3	399	Pathogen recognition; Antigen uptake; APC/T cell interactions; Cell migration	NA	27999992	2016	Pubchem_assay
PRRID_1772	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Immunostimulant	CD300b-Toll like receptor4 (TLR4) complex	Pattern recognition receptor (PRR)	Human	NA	NA	NA	NA	NA	led to the recruitment and activation of spleen tyrosine kinase (Syk) and phosphatidylinositol-4,5-bisphos- phate 3-kinase (PI3K).	NA	27261276	2016	NA
PRRID_1772	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Immunostimulant	CD300b-Toll like receptor4 (TLR4) complex	Pattern recognition receptor (PRR)	Human	NA	NA	NA	NA	NA	led to the recruitment and activation of spleen tyrosine kinase (Syk) and phosphatidylinositol-4,5-bisphos- phate 3-kinase (PI3K).	NA	27261276	2016	NA
PRRID_1802	mannitol-linked glycerogly- colipid Click for more detail	M. tuberculosis, S. pneumoniae, K. pneumo- niae, H. pylori, C. albicans, Malassezia spp. (Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Mincle	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Recognition of pathogens and necrotic cells; Induction of cytokine production	NA	27999992	2016	NA
PRRID_1802	mannitol-linked glycerogly- colipid Click for more detail	M. tuberculosis, S. pneumoniae, K. pneumo- niae, H. pylori, C. albicans, Malassezia spp. (Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Mincle	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Recognition of pathogens and necrotic cells; Induction of cytokine production	NA	27999992	2016	NA
PRRID_1803	Mannose Click for more detail	HIV-1 (virus)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	DCIR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Inhibition of APC functions such as cytokine production	NA	27999992	2016	NA
PRRID_1803	Mannose Click for more detail	HIV-1 (virus)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	DCIR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Inhibition of APC functions such as cytokine production	NA	27999992	2016	NA
PRRID_1804	Mannose Click for more detail	S. pneumoniae, K. pneumoniae, C. albicans, P.carinii, HIV-1, Dengue virus	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	MMR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Pathogen recognition; Antigen uptake; Cell adhesion; Phagocytosis	NA	27999992	2016	NA
PRRID_1804	Mannose Click for more detail	S. pneumoniae, K. pneumoniae, C. albicans, P.carinii, HIV-1, Dengue virus	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	MMR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Pathogen recognition; Antigen uptake; Cell adhesion; Phagocytosis	NA	27999992	2016	NA
PRRID_1805	mannosyl fatty acids Click for more detail	M. tuberculosis, S. pneumoniae, K. pneumo- niae, H. pylori, C. albicans, Malassezia spp.(Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Mincle	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Recognition of pathogens and necrotic cells; Induction of cytokine production	NA	27999992	2016	NA
PRRID_1805	mannosyl fatty acids Click for more detail	M. tuberculosis, S. pneumoniae, K. pneumo- niae, H. pylori, C. albicans, Malassezia spp.(Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Mincle	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Recognition of pathogens and necrotic cells; Induction of cytokine production	NA	27999992	2016	NA
PRRID_1813	NA Click for more detail	RS218 (E.coli strain) (Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Causes inflammation and activation of SCR.	SSc5D	Scavenger receptor (SR)	Human	Macrophages	Five SRCR modules, and a large C-terminal mucin-like domain	A1L4H1.fasta	A1L4H1	1573	Pathogen recognition; T cell differentiation	Microbial binding assay	27790215	2016	Pubchem_assay
PRRID_1813	NA Click for more detail	RS218 (E.coli strain) (Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Causes inflammation and activation of SCR.	SSc5D	Scavenger receptor (SR)	Human	Macrophages	Five SRCR modules, and a large C-terminal mucin-like domain	A1L4H1.fasta	A1L4H1	1573	Pathogen recognition; T cell differentiation	Microbial binding assay	27790215	2016	Pubchem_assay
PRRID_1814	NA Click for more detail	IHE3034 (E.coli strain) (Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Causes inflammation and activation of SCR.	SSc5D	Scavenger receptor (SR)	Human	Macrophages	Five SRCR modules, and a large C-terminal mucin-like domain	A1L4H1.fasta	A1L4H1	1573	Pathogen recognition; T cell differentiation	Microbial binding assay	27790215	2016	Pubchem_assay
PRRID_1814	NA Click for more detail	IHE3034 (E.coli strain) (Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Causes inflammation and activation of SCR.	SSc5D	Scavenger receptor (SR)	Human	Macrophages	Five SRCR modules, and a large C-terminal mucin-like domain	A1L4H1.fasta	A1L4H1	1573	Pathogen recognition; T cell differentiation	Microbial binding assay	27790215	2016	Pubchem_assay
PRRID_1836	O-linked mannobiose-rich glycoprotein Click for more detail	M. tuberculosis, S. enterica, S. mansoni, C. albicans, A. fumigatus, Malassezia spp.(Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Dectin-2	C type Lectin (CTL/CLR)	Human	NA	NA	Q6EIG7.fasta	Q6EIG7	209	Pathogen recognition; antigen uptake	NA	27999992	2016	Pubchem_assay
PRRID_1836	O-linked mannobiose-rich glycoprotein Click for more detail	M. tuberculosis, S. enterica, S. mansoni, C. albicans, A. fumigatus, Malassezia spp.(Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Dectin-2	C type Lectin (CTL/CLR)	Human	NA	NA	Q6EIG7.fasta	Q6EIG7	209	Pathogen recognition; antigen uptake	NA	27999992	2016	Pubchem_assay
PRRID_1842	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	Immunostimulant	Hexokinase	Pattern recognition receptor (PRR)	Human	Macrophages, Dendritic cells	NA	P52789.fasta	P52789	917	Metabolic enzyme, Trigger NLRP3 Inflammasome Activation and IL-1b Production	Proximity Ligation assay	27374331	2016	Pubchem_assay
PRRID_1842	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	Immunostimulant	Hexokinase	Pattern recognition receptor (PRR)	Human	Macrophages, Dendritic cells	NA	P52789.fasta	P52789	917	Metabolic enzyme, Trigger NLRP3 Inflammasome Activation and IL-1b Production	Proximity Ligation assay	27374331	2016	Pubchem_assay
PRRID_1850	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Immunostimulant	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	NA	NA	O15455.fasta	O15455	904	TLR3 (Poly I:C)-mediated, NO-dependent antiviral response [89] in murine embryonic fibroblasts	NA	27233799	2016	Pubchem_assay
PRRID_1850	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Immunostimulant	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	NA	NA	O15455.fasta	O15455	904	TLR3 (Poly I:C)-mediated, NO-dependent antiviral response [89] in murine embryonic fibroblasts	NA	27233799	2016	Pubchem_assay
PRRID_1868	sialyl-Lex Click for more detail	S. pneumoniae, K. pneumoniae, C. albicans, P.carinii, HIV-1, Dengue virus	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	MMR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Pathogen recognition; Antigen uptake; Cell adhesion; Phagocytosis	NA	27999992	2016	NA
PRRID_1868	sialyl-Lex Click for more detail	S. pneumoniae, K. pneumoniae, C. albicans, P.carinii, HIV-1, Dengue virus	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	MMR	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Pathogen recognition; Antigen uptake; Cell adhesion; Phagocytosis	NA	27999992	2016	NA
PRRID_1875	TDM Click for more detail	M. tuberculosis, S. pneumoniae, K. pneumo- niae, H. pylori, C. albicans, Malassezia spp.(Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Mincle	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Recognition of pathogens and necrotic cells; Induction of cytokine production	NA	27999992	2016	NA
PRRID_1875	TDM Click for more detail	M. tuberculosis, S. pneumoniae, K. pneumo- niae, H. pylori, C. albicans, Malassezia spp.(Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Mincle	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Recognition of pathogens and necrotic cells; Induction of cytokine production	NA	27999992	2016	NA
PRRID_1884	Œ±-Mannose Click for more detail	M. tuberculosis, S. enterica, S. mansoni, C. albicans, A. fumigatus, Malassezia spp.(Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Dectin-2	C type Lectin (CTL/CLR)	Human	NA	NA	Q6EIG7.fasta	Q6EIG7	209	Pathogen recognition; antigen uptake	NA	27999992	2016	Pubchem_assay
PRRID_1884	Œ±-Mannose Click for more detail	M. tuberculosis, S. enterica, S. mansoni, C. albicans, A. fumigatus, Malassezia spp.(Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Dectin-2	C type Lectin (CTL/CLR)	Human	NA	NA	Q6EIG7.fasta	Q6EIG7	209	Pathogen recognition; antigen uptake	NA	27999992	2016	Pubchem_assay
PRRID_1885	Œ±-Mannose Click for more detail	M. tuberculosis, S. pneumoniae, K. pneumo- niae, H. pylori, C. albicans, Malassezia spp.(Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Mincle	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Recognition of pathogens and necrotic cells; Induction of cytokine production	NA	27999992	2016	NA
PRRID_1885	Œ±-Mannose Click for more detail	M. tuberculosis, S. pneumoniae, K. pneumo- niae, H. pylori, C. albicans, Malassezia spp.(Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Mincle	C type Lectin (CTL/CLR)	Human	NA	NA	NA	NA	NA	Recognition of pathogens and necrotic cells; Induction of cytokine production	NA	27999992	2016	NA
PRRID_1886	Œ≤ -1,3-glucan Click for more detail	Mycobacterium spp., L. infantum, C. albicans P. carinii, A. fumigatus, C. neoformans	C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Dectin-1	C type Lectin (CTL/CLR)	Human	NA	NA	Q9BXN2.fasta	Q9BXN2	247	Pathogen recognition; T cell differentiation	NA	27999992	2016	Pubchem_assay
PRRID_1886	Œ≤ -1,3-glucan Click for more detail	Mycobacterium spp., L. infantum, C. albicans P. carinii, A. fumigatus, C. neoformans	C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Immunostimulant	Dectin-1	C type Lectin (CTL/CLR)	Human	NA	NA	Q9BXN2.fasta	Q9BXN2	247	Pathogen recognition; T cell differentiation	NA	27999992	2016	Pubchem_assay
PRRID_1891	1,3 beta glucan Click for more detail	Candida albicans(fungi)	C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	Dectin-1 (Clec7a)	Syk-coupled CLR	Human	NA	NA	Q9BXN2.fasta	Q9BXN2	247	protective role in infection model	NA	28167651	2017	Pubchem_assay
PRRID_1891	1,3 beta glucan Click for more detail	Candida albicans(fungi)	C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O	NA	Carbohydrate	Natural	Immunostimulant	Dectin-1 (Clec7a)	Syk-coupled CLR	Human	NA	NA	Q9BXN2.fasta	Q9BXN2	247	protective role in infection model	NA	28167651	2017	Pubchem_assay

previous 1 2...12 13 141516 17 18...43 44 next