1513 | SEQ ID33 | rlllrllwGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC88 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
1514 | SEQ ID34 | ryllrlllGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC89 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
1515 | SEQ ID35 | rlylrlllGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC90 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
1516 | SEQ ID36 | rllyrlllGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC91 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
1517 | SEQ ID37 | rlllryllGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC92 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
1518 | SEQ ID38 | rlllrlylGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC93 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
1519 | SEQ ID39 | rlllrllyGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC94 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
1521 | RTL401 | GGGGSLVPRGSGGGG | 15 | L | None | None | None | Linear | Protein Derived | I-As/proteolipid protein | T-cells | cytokine switch in targeted T cells to produce anti-inflammatory cytokines,reduction of infiltrating mononuclear cells into CNS | In vivo | NA | NA | SJL mice | Immunoblotting, Cytokine determination by cytometric bead array, ELISA | NA | autoimmune encepha- lomyelitis | 16148160 | 2005 |
1522 | Peptide 131-151 | RIHMVYSKRSGKPRGYAFIEY | 21 | L | None | None | None | Linear | Protein Derived | Spliceosomal U1-70K protein | HLA class II molecules | IL-10 secretion | In vivo | NA | NA | MRL/lpr mice | HLA-DR peptide-binding assay, ELISA, CFSE, PBMC Proliferation assay | NA | lupus | 16237076 | 2005 |
1524 | 119R | VAALEEANTELEVKI | 15 | L | None | None | None | Linear | Protein Derived | keratin 17 | Psoriatic T-cells and keratinocyte | Inhibition of T-cell proliferation , secretion of interferon gamma and interleukin 2 and up-regulation of interleukins 4 and 10 | In vitro | NA | NA | NA | Cytokine secretion assay, T-cell proliferation assay | NA | NA | 16713453 | 2006 |
1525 | 355L | ENRYCVQASQIQGLI | 15 | L | None | None | None | Linear | Protein Derived | keratin 18 | Psoriatic T-cells and keratinocyte | Inhibition of T-cell proliferation , secretion of interferon gamma and interleukin 2 and up-regulation of interleukins 4 and 11 | In vitro | NA | NA | NA | Cytokine secretion assay, T-cell proliferation assay | NA | NA | 16713453 | 2006 |
1526 | A12 | GEBGIAGNKGDQGPKGEBGPA | 21 | L | None | None | None | Linear | Protein Derived | Type II collagen | T-cells | Decrease in IFN-γ and increase in IL-4 production | In vivo | NA | NA | DR4 transgenic Mice | ELISA, Class II binding assay, Proliferation assay | NA | NA | 16982003 | 2006 |
1527 | Bet v 1 141-156 | GETLLRAVESYLLAHS | 16 | L | None | None | None | Linear | Protein Derived | birch pollen allergen Bet v 1 | Bet v 1-re- active Treg | Higher levels of IL-10 by Th and suppression of other T helper cells via cell-cell contact | In vitro | Mouse fibroblasts cell lines (L cells), CTLL-2 | NA | NA | CTLL-2 cell proliferation assay, ELISA, RT-PCR, FACS | NA | NA | 17202384 | 2007 |
1528 | Bet v 1 51-68 | PGTIKKISFPEGFPFKYV | 18 | L | None | None | None | Linear | Protein Derived | birch pollen allergen Bet v 2 | Bet v 1-re- active Treg | Higher levels of IL-10 by Th and suppression of other T helper cells via cell-cell contact | In vitro | Mouse fibroblasts cell lines (L cells), CTLL-3 | NA | NA | CTLL-2 cell proliferation assay, ELISA, RT-PCR, FACS | NA | NA | 17202384 | 2007 |
1529 | p33-48 | DSVTPMILKAQK GGNL | 16 | L | None | None | None | Linear | Protein Derived | Dog allergen Can f 1 | T-Cells | Elevated production of IFN-c and IL-10 | In vitro | Peptide-specific T cell lines | NA | NA | Lymphocyte proliferation assay, ELISA, FACS | NA | NA | 17233739 | 2006 |
1530 | p107-122 | RQIRMAKLLGRDPEQS | 16 | L | None | None | None | Linear | Protein Derived | Dog allergen Can f 2 | T-Cells | Elevated production of IFN-c and IL-11 | In vitro | Peptide-specific T cell lines | NA | NA | Lymphocyte proliferation assay, ELISA, FACS | NA | NA | 17233739 | 2006 |
1533 | MOG peptide | MEVGWYRSPFSRVVHLYRNGK | 21 | L | None | None | None | Linear | Protein Derived | Myelin oligodendrocyte glycoprotein | IL-10, TGF-β | Not Available | In vivo | NLDC-145 for DEC205 and GL117 for b-galactosidase | NA | C57/Bl6 mice, 2D2 mice or BALB/c mice | Proliferation assay | NA | NA | 23945139 | 2013 |
1534 | Preproinsulin-1 L7-24 peptide | FLPLLALLALWEPKPTQA | 18 | L | None | None | None | Linear | Protein Derived | Preproinsulin | IL-4, IL-10, TGF-β | Induces regulatory T cells | In vivo | NA | NA | NOD/Shi/Kbe mice | Quantikine immunoassay kit | NA | NA | 20359955 | 2010 |
1535 | MOG35-55 | MEVGWYRSPFSRVVHLYRNGK | 21 | L | None | None | None | Linear | Protein Derived | Myelin oligodendrocyte glycoprotein | IL-10, TGF-β1, FoxP3 | Not Available | Both | splenocytes | NA | C57BL/6 mice | Proliferation assay | NA | NA | 23077616 | 2012 |
1536 | MSP1 peptide | ISVLKSRLLKRKKYI | 15 | L | None | None | None | Linear | Protein Derived | merozoite surface protein 1 (MSP1) | IL-10 | Not Available | Both | CTLL-2 cells, B5 CD4 T cell hybridoma | NA | BALB/c mice | NA | NA | NA | 23006847 | 2012 |
1538 | ApoB peptide | CIEIGLEGKGFEPTLEALFGK | 21 | L | None | None | None | Linear | Protein Derived | Apolipoprotein B100 (ApoB) | IL-10, TGF-β | Induced T-cell proliferation and expansion of regulatory T cells | Both | Splenocytes, Dendritic Cells | NA | C57BL6/J | Cytometric bead assay | NA | NA | 23400302 | 2013 |
1539 | HSP60 peptide | CAELKKQSKPVT | 12 | L | None | None | None | Linear | Protein Derived | Heat shock protein 60 (HSP60) | IL-10, TGF-β | Induced T-cell proliferation and expansion of regulatory T cells | Both | Splenocytes, Dendritic Cells | NA | C57BL6/J | Cytometric bead assay | NA | NA | 23400302 | 2013 |
1540 | Peptide A | CTLDLNTPVDKTSN | 14 | L | None | None | None | Linear | Protein Derived | Complement receptor 5a | TNF-α | Slightly stimulates T cells | Both | Splenocytes, Dendritic Cells | NA | C57BL6/J | Cytometric bead assay | NA | NA | 23400302 | 2013 |
1541 | MOG35-55 peptide | MEVGWYRSPFSRVVHLYRNGK | 21 | L | None | None | None | Linear | Protein Derived | Myelin oligodendrocyte glycoprotein | IL-10 | Not Available | Both | Spleen cells | NA | C57BL/6 and IL-10-/-(B6.129P2-Il10tmlCgn/J) mice | Proliferation assay | NA | NA | 20624940 | 2010 |
1542 | Cry j 1 peptide (61-75) | GATRDRPLWIIFSGN | 15 | L | None | None | None | Linear | Protein Derived | Cry j 1 protein | IL-10 | Production of CD4+CD25+ Treg cells | In vitro | Heparinized venous blood | NA | NA | CFSE-based proliferation assay, ELISPOT assay | NA | NA | 21597299 | 2011 |
1543 | MOG35-55 peptide | MEVGWYRSPFSRVVHLYRNGK | 21 | L | None | None | None | Linear | Protein Derived | Myelin oligodendrocyte glycoprotein | IL-10 | Not Available | Both | Spleen and lymph node cells | NA | C57BL/6 mice | Bio-Plex Cytokine Assay | NA | NA | 23033382 | 2012 |
1544 | HSP70 Mtb 234-252 | LREAAEKAIELSSSQSTS | 19 | L | None | None | None | Linear | Natural | M.tb. Hsp70 | Peritoneal cavity | Produce large amount of IL-10. | Both | RT1 B-restricted T cell line | NA | Male Lewis rats | ELISA | NA | NA | 10553084 | 1999 |
1545 | H471 | TYTEHAKRKTVTAMDVVYALKRQ | 23 | L | None | None | None | Linear | Protein Derived | Histone H4 protein | T-cell epitope of histone protein H4 of mononucleosome | Producing large amount of IL-10 and decreasing IFN-gamma by lymph node cells | Both | LN cells | NA | Lupus prone SNF1 female mice | ELISA, Cell Proliferation Assay, Ce1ELISA | NA | CFA | 12097422 | 2002 |
1546 | CII(256-276, N263, D266) | GEBGIAGFKGEQGPKGEBGA | 21 | L | None | None | None | Linear | Protein Derived | Type II Collagen | Spleen and Lymph node | Produce large amount of IL-4. | in vivo | None | NA | HLA-DR1 Transgenic mice, C57BL/6 IL-4 knockout mice | Class II binding assay, ELISA | NA | NA | 12483744 | 2002 |
1547 | α3-71-91 | VNDVCNFASRNDYSYWLSTPA | 20 | L | None | None | None | Linear | Protein Derived | α3(IV)NC1 | HLA-DR15 | Produce large amount of IL-10. | in vitro | PBMC | NA | None | ELISA | NA | NA | 14569090 | 2003 |
1548 | α3-131-151 | IPPCPHGWISLWKGFSFIMF | 20 | L | None | None | None | Linear | Protein Derived | α3(IV)NC1 | HLA-DR15 | Produce large amount of IL-10. | in vitro | PBMC | NA | None | ELISA | NA | NA | 14569090 | 2003 |
1549 | GAD-500-585 | QHTNVCFWFVPPSLRVLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLEEIERLGQDL | 85 | L | None | None | None | Linear | Synthetic | E.coli BL-21 | Effector T cells | Inctreased production of IL-4, IL-10, TGF- beta and IFN-gamma cells | in vivo | None | NA | NOD mice | ELISA, ELISPOT Assay | NA | Adeno Associated Virus | 15814672 | 2005 |
1550 | R9-SOCS1-KIR | RRRRRRRRRDTH-FRTFRSHSDYRRI | 25 | L | None | None | None | Linear | Protein Derived | kinase inhibitory region (KIR) of the intracellular checkpoint protein suppressor of cytokine signaling 1 (SOCS-1 | phospho-tyrosine containing regions of the tyrosine kinases JAK2 and TYK2 and the adaptor protein MAL | By blocking the inflammtory effects of IFN-γ, TNF-α or IL-17A. | Both | ARPE-19 cell | NA | B10. RIII mice | immunohistochemistry | NA | NA | 30048621 | 2018 |
1551 | altered peptide ligand (APL), | HSLGKQLGHPDKF | 13 | L | None | None | None | Linear | Synthetic | Subsitution of trytophan to glutamine in myelin proteolipid protein | Cross reacts with native peptide | Induces T- cells that produces Th2 (IL-4 and IL-10) and Th0 (IFN-γ and IL-10) | Both | T cell lines | NA | Female (4 to 6week-old) SJL mice | In vitro cytokine assays | NA | NA | 7584131 | 1995 |
1552 | P1182-1194 | WEGVGVVPDVAVP | 13 | L | None | None | None | Linear | Protein Derived | interphotoreceptor retinoid-binding protein (IRBP)-derived peptide | NA | Induces T cells production with IL-4 and IL-10 | Both | Peptide specific T cell lines | NA | BALB/c nude mice | Lymphocyte proliferation assay | NA | NA | 9603463 | 1998 |
1553 | 262Lys | VIVKLIPSTSSAV | 13 | L | None | None | None | Linear | Synthetic | Analog of Peptide p259-271 of the human acetylcholine receptor a-subunit | NA | Inhibited complete secretion of IL-2 and IL-4 and inhibit effeicintly IL-10 and TNF-α | Both | T cell line | NA | Female mice of the inbred strain BALBrc | Cytokine detection | NA | NA | 9627000 | 1998 |
1554 | 262Ser | VIVSLIPSTSSAV | 13 | L | None | None | None | Linear | Synthetic | Analog of Peptide p259-271 of the human acetylcholine receptor a-subunit | NA | Inhibited complete secretion of IL-2 and IL-4 and inhibit effeicintly IL-10 and TNF-α | Both | T cell line | NA | Female mice of the inbred strain BALBrc | Cytokine detection | NA | NA | 9627000 | 1998 |