| 1102 | ISP-GP41 (583-599) | VERYLKDQQLLGIWGCS | 17 | L | None | None | None | Linear | Protein Derived | HIV-l (derived from clone BH10) | Con A | Inhibits protein kinase C (PKC) activity | In vitro | Human H9, Jurkat, Raji, Daudi. U937 and HEF cell lines | NA | NA | BrdU-Labeling and Detection-Kit | NA | NA | 8847089 | 1995 |
| 1103 | HIV-1 gp41 (conjugated with BSA) | LQARILAVERYLKDQQL | 17 | L | None | None | None | Linear | Protein Derived | HIV-1 isolate IIIB | NA | Mimics the effect of human IFN-α and -β on regulation of human MHC class I expression | In vitro | Human H9, Jurkat, Raji, Daudi. U937 and HEF cell lines | NA | NA | NA | NA | NA | 9373217 | 1997 |
| 1104 | HIV-1 soluble gp41 (sgp41) (539-684) | VQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKI | 146 | L | None | None | None | Linear | Protein Derived | HIV-1 isolate IIIB | NA | Enhances MHC class I expression | In vitro | Human H9, Jurkat, Raji, Daudi. U937 and HEF cell lines | NA | NA | NA | NA | NA | 9373217 | 1997 |
| 1105 | Heme oxygenase-1 (HO-1) Peptide D2702.75-84 | RENLRIALRY | 10 | L | None | None | None | Linear | Protein Derived | α1-helix of HLA-B2702 | HSC70 and HSP70 | Not Available | Both | Human T cell leukemia cell line Jurkat (clone E6-1) and a mouse lymphoma cell line Yac-1 | NA | Male, 7-8-week-old CBA/J (H-2k) and C57BL/6/J (H-2b) mice | NA | NA | NA | 9446574 | 1997 |
| 1106 | Heme oxygenase-1 (HO-1) Peptide D2702.75-84(E-V) | rvnlrialry | 10 | D | None | None | None | Linear | Protein Derived | α1-helix of HLA-B2703 | NA | Not Available | Both | Human T cell leukemia cell line Jurkat (clone E6-1) and a mouse lymphoma cell line Yac-2 | NA | C57Bl/6 and CBA mice | NA | NA | NA | 9446574 | 1997 |
| 1107 | HAP-1 | SFHQFARATLAS | 12 | L | Addition of Cysteine | None | None | Linear | Synthetic | M13 peptide phage library of a rabbit synovial fibroblast cell line | NA | Not Available | In vivo | NA | NA | Female Wistar rat | NA | NA | NA | 245138095 | 2014 |
| 1108 | Core peptide (CP) | GLRILLLKV | 9 | L | None | None | None | Linear | Synthetic | NA | NA | Not Available | In vivo | NA | NA | Female Wistar rat | NA | NA | NA | 245138095 | 2014 |
| 1109 | Scrambled HAP-1 peptide (scHAP1) | ALSQAFRHAFTS | 12 | L | Addition of Cysteine | None | None | Linear | Synthetic | NA | NA | Not Available | In vivo | NA | NA | Female Wistar rat | NA | NA | NA | 245138095 | 2014 |
| 1110 | H17 | LQNRRGLDLLTAEKGGL | 17 | L | None | Amidation | None | Linear | Protein Derived | Human endogenous retroviruses HERV-H/env60 (HERV-H) | NA | Induces CCL19 production in tumor cells, promotion of both CD271+ cell-governing immunosuppression and tumor invasion via the Twist-PI3K pathway. | Both | Colon cancer Colo320 and HCT116,pancreatic cancer MIAPaca and Panc1,melanoma Hs294T, andnormal epithelial cell ARPE19 | NA | Female BALB/c nu/nu mice | WST1 assay | NA | NA | 24590808 | 2014 |
| 1111 | Collutellin A | VISIIPV | 7 | L | None | None | None | Cyclic | Natural | Colletotrichum dematium (fungus) | IL-2 | Reduces IL2 production | In vitro | C57/B6 mice spleen cells | 167.3+/-0.38 nM | C57/B6 mice | NA | NA | NA | 24333193 | 2014 |
| 1112 | Antamides | VPPAFFPPFF | 10 | L | None | None | None | Cyclic | Natural | Amanita phalloides spp. (fungus) | NA | Inhibition of mitochondrial permeability transition pores | Both | fibroblasts | NA | C57BL/6 mice | NA | NA | NA | 24333193 | 2014 |
| 1114 | Didemnin A/B | not available | 0 | L | None | None | None | Cyclic | Natural | Trididemnum solidum (tunicate) | eEFA1 and PPT-1 | Blocks protein and RNA synthesis, binds to eEFA1 and PPT-1 | In vivo | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
| 1115 | FK506 (tracrolimus) Ascomycin (pimecrolimus,SDZ ASM 981) | not available | 0 | L | None | None | None | Cyclic | Natural | Streptomyces tsukubaensis (bacteria) | Calcineurin | Inhibition of calcineurin by complex with FK binding proteins | Both | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
| 1116 | Homophymines | not available | 0 | L | None | None | None | Cyclic | Natural | Homophymia spp. (marine sponge) | NA | Antiproliferative, mechanism unknown | In vitro | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
| 1117 | Geodiamolides H | not available | 0 | L | None | None | None | Cyclic | Natural | Geodia corticostylifera (marine sponge) | Actin filaments | Disorganization of actin filaments | In vitro | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
| 1118 | Hymenistatin I | not available | 0 | L | None | None | None | Cyclic | Natural | Hymeniucidon spp. (marine sponge) | NA | Modulation of the IL2 cell response (comparable with rapamycin) | In vivo | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
| 1119 | Jasplakinolide | not available | 0 | L | None | None | None | Cyclic | Natural | Jaspis splendens (marine sponge) | Actin | Actin stabilization, induces actin polymerization | In vitro | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
| 1120 | Sirolimus (rapamycin), everolimus (and derivatives) | not available | 0 | L | None | None | None | Cyclic | Natural | Streptomyces hygroscopius (bacteria) | mTOR | Inhibition of mTOR | Both | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
| 1122 | Curcacycline B (Orbitide) | LGSPILLGI | 9 | L | None | None | None | Cyclic | Natural | Jatropha curcas (plant) | PPIase | PPIase inhbitior | In vitro | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
| 1123 | Cycloleonurinin (Orbitide) | GPTQYPPYYlTP | 13 | Mix | None | None | None | Cyclic | Natural | Leonurus heterophyllus (plant) | NA | Not known | In vitro | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
| 1124 | Cyclolinopeptide A/B (Orbitide) | IMLIPPFFV | 9 | L | None | None | None | Cyclic | Natural | Linum usitatissimum (plant) | Calcineurin | CYPA binding and calcineurin inhibition | In vivo | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
| 1127 | Kaliotoxin (Venom peptide) | GVEINVKCSGSPQCLKPCLDAGMRFGKCMNRKCHCTPK | 38 | L | None | None | None | Linear | Natural | Androctonus mauretanicus (scorpion) | K+ channel | Potassium channel blocker | In vitro | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
| 1129 | OSK-1 (alpha-KTx3.7) (Venom peptide) | GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | None | Linear | Natural | Orthochirus scrobiculosus (scorpion) | K+ channel | Potassium channel blocker | Both | NA | NA | C57/BL6 mice | NA | 10 mg/kg | NA | 24333193 | 2014 |
| 1130 | CKS-17 | LQNRRGLDLLFLKEGGLC | 18 | L | None | None | None | Linear | Protein Derived | murine leukemia virus (MLV) | TNF-α | Significantly reduces the mRNA levels of IL-17C, TNF-α, IL-6 and CXCL2 | Both | Acute allergic contact dermatitis model and TPA toxic eczema model | NA | C57BL/6 mice and BALB/CJ mice | NA | NA | NA | 24245569 | 2013 |
| 1131 | core peptide (CP) | GLRILLLKV | 9 | L | None | None | None | Linear | Protein Derived | T-cell antigen receptor alpha-chain transmembrane region | IL-2 | Inhibits IL-2 production | In vitro | Alanine scan, LK antigen-presenting cells | NA | NA | Antigen presentation assay, CTLL assay | NA | NA | 23066996 | 2013 |
| 1132 | Vm24 | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC | 36 | L | None | None | None | Linear | Natural | Vaejovis mexicanus smithi (scorpion) | Kv1.3 channels | Inhibits Kv1.3 channels | Both | COS-7, human embryonic kidney 293, tsA201, L929 and MEL cells | NA | Female Lewis rat (9-10 weeks of age) | Proliferation assay | NA | NA | 22622363 | 2012 |
| 1134 | Thalassospiramide A | not available | 0 | L | None | None | None | Cyclic | Natural | α-proteobacterium (strain CNJ-328) | IL-5 | Inhibition of IL-5 | In vitro | lymphocytes | 10 micromolar | NA | NA | NA | NA | 17373804 | 2007 |
| 1135 | Thalassospiramide B | not available | 0 | L | None | None | None | Cyclic | Natural | α-proteobacterium (strain CNJ-328) | IL-5 | Inhibition of IL-6 | In vitro | lymphocytes | 5 micromolar | NA | NA | NA | NA | 17373804 | 2007 |
| 1136 | Nonapeptide of HLA-DR | VPRSGEVYT | 9 | L | None | None | None | Linear | Synthetic | NA | NA | NA | Both | Spleen Cells | NA | CBA, BALB/c and C57BL, 8-12 weeks old mice | Plaque-forming cells (PFC) and delayed type hypersensitivity (DTH) assay | NA | NA | 15063002 | 2004 |
| 1137 | Lympho-inhibitory peptide | not available | 26 | NA | None | None | None | Linear | Natural | Mycoplasma bovis | NA | NA | In vitro | Bovine peripheral blood mononuclear cells (PBMCs) | NA | NA | NA | NA | NA | 14766212 | 2004 |
| 1138 | VIVIT (fused with GST) | VIVIT | 5 | L | None | None | None | Linear | Synthetic | NA | NFAT | Inhibits NFAT activation | In vitro | COS7 cells, HeLa cells, BHK cells, and NIH3T3 cells | NA | Hippocampal primary neurons of rat | NA | NA | fused with GST | 12763035 | 2003 |
| 1140 | CKS-17 | LQNRRGLDLLFLKEGGL | 17 | L | None | None | None | Linear | Synthetic | NA | Protein kinase | Activates mitogen-activated protein (MAP) kinases extracellular signal-regulated kinase 1 and 2 (ERK1/2) | In vitro | Human monocytic cell line THP-1 | NA | NA | NA | NA | NA | 11359835 | 2001 |
| 1141 | Glycodelin-A | MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF | 180 | L | None | None | None | Linear | Protein Derived | NA | IL-2 | Glycodelin-A interrupts the production of interleukin-2 (IL-2) by lymphocytes and inhibits the IL-2 activation of natural killer cells | In vitro | Cervical tissue | NA | NA | NA | NA | NA | 11063647 | 2000 |
| 1142 | RDP1258 | RNleNleNleRNleNleNleGY | 22 | L | None | Amidation | None | Linear | Protein Derived | NA | TNF-α | Enhanced expression of splenic heme oxygenase 1 (HO-1). Decreased expression of tumor necrosis factor a (TNF-α) mRNA; and an increased level of inducible nitric oxide synthase (iNOS) mRNA. | In vivo | NA | 20 micromolar | Eight- to 12-week-old male Lewis.lW (RTI.u) and Lewis.lA (RTI.')rats | Graft transplation assay | NA | NA | 10666482 | 2000 |
| 1143 | HLA B-2702 (2702.75-84) | RENLRIALRY | 10 | L | None | None | None | Linear | Natural | NA | T-cell | Inhibits the differentiation of cytotoxic T cells and also decrease natural killer (NK) cell-mediated cytotoxicity | In vivo | NA | NA | Eight- to 12-week-old male Lewis.lW (RTI.u) and Lewis.lA (RTI.')rats | Graft transplation assay | NA | NA | 10666482 | 2000 |
| 1144 | B-0701 (07.75-84) | RESLRNLRGY | 10 | L | None | None | None | Linear | Natural | NA | T-cell | Inhibits the differentiation of cytotoxic T cells and also decrease natural killer (NK) cell-mediated cytotoxicity | In vivo | NA | 200 micromolar | Eight- to 12-week-old male Lewis.lW (RTI.u) and Lewis.lA (RTI.')rats | Graft transplation assay | NA | NA | 10666482 | 2000 |
| 1146 | HLA-B2702 (2702.75-84) | RENLRIALRY | 10 | L | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 1.0±0.4 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
| 1147 | 2702.84-75 | YRLAIRLNER | 10 | L | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 1.2 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
| 1148 | D2702.75-84 | renrialry | 9 | D | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 0.15±0.05 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
| 1149 | D2702.84-75 | yrlairlner | 10 | D | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 0.3 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
| 1150 | P2 | RVNLRIALRY | 10 | L | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 0.15±0.08 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
| 1151 | RP2 | YRLAIRLNVR | 10 | L | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 0.2 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
| 1152 | D2 | rvnlrialry | 10 | D | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 0.17±0.09 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
| 1153 | RD2 | yrlairlnvr | 10 | D | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 0.3 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
| 1154 | P15 | NLRIALAYYW | 10 | L | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 0.2 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
| 1155 | RDP1257 | RLLLRLLLGY | 10 | L | None | None | None | Linear | Natural | HLA/MHC molecule | NA | Not Available | Both | In silico screening (MD simulations) | 1.4±0.2 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
| 1156 | RDP1259 | RVLLRLLLGY | 10 | L | None | None | None | Linear | Natural | HLA/MHC molecule | NA | Not Available | Both | In silico screening (MD simulations) | 1.4±0.15 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
| 1157 | RDP1271 | RWLLRLLLGY | 10 | L | None | None | None | Linear | Natural | HLA/MHC molecule | NA | Not Available | Both | In silico screening (MD simulations) | 1.4±0.3 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
| 1158 | RDP1277 | RYLLALLLGY | 10 | L | None | None | None | Linear | Natural | HLA/MHC molecule | NA | Not Available | Both | In silico screening (MD simulations) | 1.4±0.2 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
| 1159 | RDP1258 | RnlnlnLRnlnLnLGY | 16 | Mix | None | None | None | Linear | Natural | HLA/MHC molecule | NA | Not Available | Both | In silico screening (MD simulations) | 1.2±0.2 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
