Fermented Food Database
This is the result page of browse. This page gives the information about peptides returned against the selected category. Further details of the peptide can be seen by clicking on the FMDB_ID. Further the user can sort the peptides on the basis of various fields by clicking on the respective headers.
The total number entries retrieved from this search are 374| FMDB_ID | PubMed ID | Reference | Title | Peptide_Sequence | Sequence | Length of peptide | Food_Matrix | Protein | pH | Temperature | Incubation Time | Activity | Experiment | Model | Assay for Activity Measurement | Culture | Hydrolysis | Method of analysis | M_Z ratio | Mass | IC50 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| FMDB4 | 8201050 | NA | NA | AYFYPE | AYFYPE | 6 | Milk | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790 | proteinase | NA | NA | NA | 106uM |
| FMDB7 | 8201050 | NA | NA | GTQYTDAPSFSDIPNPIGSENSEKTTMPLW | GTQYTDAPSFSDIPNPIGSENSEKTTMPLW | 30 | Milk | αS1-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 346uM |
| FMDB23 | 10416158 | NA | NA | YP | YP | 2 | Yogurt like product | αS1-Casein | 4.3 | NA | NA | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CPN4 | proteinase | NA | NA | NA | 720uM |
| FMDB85 | 26877633 | NA | NA | LPQEVLNENLL | LPQEVLNENLL | 11 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 652.3267+2 | NA | NA |
| FMDB86 | 26877633 | NA | NA | LPQEVLNENLLRF | LPQEVLNENLLRF | 13 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 792.9204+2 | NA | NA |
| FMDB87 | 26877633 | NA | NA | APFPEVFGK | APFPEVFGK | 9 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 496.2541+2 | NA | NA |
| FMDB88 | 26877633 | NA | NA | APSFSDIPNPIGSEN | APSFSDIPNPIGSEN | 15 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 783.8367+2 | NA | NA |
| FMDB89 | 26877633 | NA | NA | APSFSDIPNPIGSENSEKTTMP | APSFSDIPNPIGSENSEKTTMP | 22 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 1160.019+2 | NA | NA |
| FMDB90 | 26877633 | NA | NA | APSFSDIPNPIGSENSEKTTMPLW | APSFSDIPNPIGSENSEKTTMPLW | 24 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 878.7391+2 | NA | NA |
| FMDB91 | 26877633 | NA | NA | PSFSDIPNPIGSENSEKTTMP | PSFSDIPNPIGSENSEKTTMP | 21 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 1102.488+2 | NA | NA |
| FMDB92 | 26877633 | NA | NA | SFSDIPNPIGSENSEKTTMPLW | SFSDIPNPIGSENSEKTTMPLW | 22 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 1225.555+2 | NA | NA |
| FMDB93 | 26877633 | NA | NA | FSDIPNPIGSENSEKTTMPLW | FSDIPNPIGSENSEKTTMPLW | 21 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 1182.031+2 | NA | NA |
| FMDB94 | 26877633 | NA | NA | SDIPNPIGSENSEKTTMPLW | SDIPNPIGSENSEKTTMPLW | 20 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 1108.502+2 | NA | NA |
| FMDB95 | 26877633 | NA | NA | DIPNPIGSENSEKTTMPLW | DIPNPIGSENSEKTTMPLW | 19 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 1064.983+2 | NA | NA |
| FMDB96 | 26877633 | NA | NA | IPNPIGSENSEKTTMPL | IPNPIGSENSEKTTMPL | 17 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 905.4299+2 | NA | NA |
| FMDB97 | 26877633 | NA | NA | IPNPIGSENSEKTTMPLW | IPNPIGSENSEKTTMPLW | 18 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 1015.474+2 | NA | NA |
| FMDB98 | 26877633 | NA | NA | PIGSENSEKTTMPLW | PIGSENSEKTTMPLW | 15 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 853.3911+2 | NA | NA |
| FMDB99 | 26877633 | NA | NA | IGSENSEKTTMPLW | IGSENSEKTTMPLW | 14 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 807.8565+2 | NA | NA |
| FMDB100 | 26877633 | NA | NA | SENSEKTTMPLW | SENSEKTTMPLW | 12 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 711.8127+2 | NA | NA |
| FMDB127 | 26996626 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | Milk | αS1-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1665.5 | NA | NA |
| FMDB128 | 26996626 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | Milk | αS1-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1665.5 | NA | NA |
| FMDB129 | 26996626 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | Milk | αS1-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1665.5 | NA | NA |
| FMDB130 | 26996626 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | Milk | αS1-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1665.5 | NA | NA |
| FMDB143 | 26996626 ; 16899668 | NA | NA | RPKHPIKHQGLPQEVLNEN | RPKHPIKHQGLPQEVLNEN | 19 | Milk | αS1-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2235 | NA | NA |
| FMDB144 | 26996626 ; 16899668 | NA | NA | RPKHPIKHQGLPQEVLNEN | RPKHPIKHQGLPQEVLNEN | 19 | Milk | αS1-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2235 | NA | NA |
| FMDB145 | 26996626 ; 16899668 | NA | NA | RPKHPIKHQGLPQEVLNEN | RPKHPIKHQGLPQEVLNEN | 19 | Milk | αS1-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2235 | NA | NA |
| FMDB148 | 26996626 ; 16899668 | NA | NA | RPKHPIKHQGLPQEVLNENL | RPKHPIKHQGLPQEVLNENL | 20 | Milk | αS1-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2348.3 | NA | NA |
| FMDB149 | 26996626 | NA | NA | RPKHPIKHQGLPQEVLNENL | RPKHPIKHQGLPQEVLNENL | 20 | Milk | αS1-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2348.3 | NA | NA |
| FMDB150 | 26996626 | NA | NA | RPKHPIKHQGLPQEVLNENL | RPKHPIKHQGLPQEVLNENL | 20 | Milk | αS1-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2348.3 | NA | NA |
| FMDB151 | 26996626 | NA | NA | RPKHPIKHQGLPQEVLNENL | RPKHPIKHQGLPQEVLNENL | 20 | Milk | αS1-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2348.3 | NA | NA |
| FMDB156 | 26996626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Milk | αS1-Casein | 3.83 ± 0.2 | 41c | 48h | Anti-microbial against S.aureus | In vivo | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2764.4 | NA | NA |
| FMDB157 | 26996626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Milk | αS1-Casein | 4.27 ± 0.15 | 41c | 48h | Anti-microbial against S.aureus | In vivo | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2764.4 | NA | NA |
| FMDB158 | 26996626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Milk | αS1-Casein | 4.32 ± 0.6 | 41c | 48h | Anti-microbial against S.aureus | In vivo | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2764.4 | NA | NA |
| FMDB159 | 26996626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Milk | αS1-Casein | 4.39± 0.22 | 41c | 48h | Anti-microbial against S.aureus | In vivo | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2764.4 | NA | NA |
| FMDB195 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | LKDTRNE | LKDTRNE | 7 | Camel skimmed Milk | αS1-Casein | 4.6 | 42c | 7h | Red blood cell binding | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB196 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | LKDTRNEPTEDH | LKDTRNEPTEDH | 12 | Camel skimmed Milk | αS1-Casein | 4.6 | 42c | 7h | NA | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB323 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB324 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB325 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB326 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB327 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB328 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB329 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB330 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB331 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB332 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB333 | 22103626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB334 | 22103626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB335 | 22103626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB336 | 22103626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB340 | 21787916 | NA | NA | EVLNENLLRF | EVLNENLLRF | 10 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lactobacillus casei | proteinase and peptidase | LC-ESI-MS | 624 (+2) | 1236.82 | 5.3 ± 0.10ug/ml |
| FMDB341 | 21787916 | NA | NA | FVAPFPEVFGK | FVAPFPEVFGK | 11 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lactobacillus casei | proteinase and peptidase | LC-ESI-MS | 619.4 (+2) | 1245.86 | 5.3 ± 0.10ug/ml |
| FMDB343 | 21787916 | NA | NA | RPKHPIKHQGLPQEV | RPKHPIKHQGLPQEV | 15 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 945.2 (+2) | 1893.38 | 10.4 ± 0.40 ug/ml |
| FMDB344 | 21787916 | NA | NA | RPKHPIKHQGLPQEVLNENLLR | RPKHPIKHQGLPQEVLNENLLR | 22 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 922.3 (+2) | 2763.87 | 10.4 ± 0.40 ug/ml |
| FMDB345 | 21787916 | NA | NA | FVAPFPEVFGK | FVAPFPEVFGK | 11 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 619.5 (+2) | 1236.9 | 10.4 ± 0.40 ug/ml |
| FMDB346 | 21787916 | NA | NA | EVLNENLLRF | EVLNENLLRF | 10 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 624.2 (+2) | 1246.22 | 10.4 ± 0.40 ug/ml |
| FMDB356 | 22901481 | NA | NA | AESIS | AESIS | 5 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | αS1-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 506.9(+3) | 505.9 | NA |
| FMDB358 | 22901481 | NA | NA | HIQKEDVPS | HIQKEDVPS | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | αS1-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 526.7(+2) | 1051.4 | NA |
| FMDB382 | 25613046 | NA | NA | FVAPFPE | FVAPFPE | 7 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter Culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 806.41(+2) | NA | NA |
| FMDB383 | 25613046 | NA | NA | GKEKVNEL | GKEKVNEL | 8 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter Culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 916.51(+2) | NA | NA |
| FMDB384 | 25613046 | NA | NA | DIKQMEAE | DIKQMEAE | 8 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 963.45(+2) | NA | NA |
| FMDB385 | 25613046 | NA | NA | VPSERYLG | VPSERYLG | 8 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 920.48(+2) | NA | NA |
| FMDB386 | 25613046 | NA | NA | IPNPIGSEN | IPNPIGSEN | 9 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 940.47(+2) | NA | NA |
| FMDB387 | 25613046 | NA | NA | QKEPMIGVN | QKEPMIGVN | 9 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1015.52(+2) | NA | NA |
| FMDB388 | 25613046 | NA | NA | QKEPMIGVN | QKEPMIGVN | 9 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1015.52(+2) | NA | NA |
| FMDB389 | 25613046 | NA | NA | DIPNPIGSEN | DIPNPIGSEN | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1055.50(+2) | NA | NA |
| FMDB390 | 25613046 | NA | NA | DIPNPIGSEN | DIPNPIGSEN | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1055.50(+2) | NA | NA |
| FMDB391 | 25613046 | NA | NA | FGKEKVNEL | FGKEKVNEL | 9 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1063.58(+2) | NA | NA |
| FMDB392 | 25613046 | NA | NA | FGKEKVNEL | FGKEKVNEL | 9 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1063.58(+2) | NA | NA |
| FMDB393 | 25613046 | NA | NA | EDIKQMEAE | EDIKQMEAE | 9 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1092.49(+2) | NA | NA |
| FMDB394 | 25613046 | NA | NA | EDIKQMEAE | EDIKQMEAE | 9 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1092.49(+2) | NA | NA |
| FMDB395 | 25613046 | NA | NA | QAMEDIKQM | QAMEDIKQM | 9 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1093.5(+2) | NA | NA |
| FMDB396 | 25613046 | NA | NA | AQQKEPMIGV | AQQKEPMIGV | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1100.58(+2) | NA | NA |
| FMDB397 | 25613046 | NA | NA | SEKTTMPLW | SEKTTMPLW | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1108.53(+2) | NA | NA |
| FMDB398 | 25613046 | NA | NA | PNSAEERLH S3 (phospho) | PNSAEERLH | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1132.48(+2) | NA | NA |
| FMDB399 | 25613046 | NA | NA | KVPQLEIVPN | KVPQLEIVPN | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1136.67(+2) | NA | NA |
| FMDB400 | 25613046 | NA | NA | KVPQLEIVPN | KVPQLEIVPN | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1136.67(+2) | NA | NA |
| FMDB401 | 25613046 | NA | NA | SAEERLHSM S1 (phospho) | SAEERLHSM | 9 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1139.46 +2 | NA | NA |
| FMDB402 | 25613046 | NA | NA | SAEERLHSM S1 (phospho) | SAEERLHSM | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1139.46 +2 | NA | NA |
| FMDB403 | 25613046 | NA | NA | SDIPNPIGSEN | SDIPNPIGSEN | 11 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1142.53 +2 | NA | NA |
| FMDB404 | 25613046 | NA | NA | EIVPNSVEQK | EIVPNSVEQK | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1142.61 +2 | NA | NA |
| FMDB405 | 25613046 | NA | NA | QKEPMIGVNQ | QKEPMIGVNQ | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1143.58 +2 | NA | NA |
| FMDB406 | 25613046 | NA | NA | QKEPMIGVNQ | QKEPMIGVNQ | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1143.58 +2 | NA | NA |
| FMDB407 | 25613046 | NA | NA | VFGKEKVNEL | VFGKEKVNEL | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1162.65 +2 | NA | NA |
| FMDB408 | 25613046 | NA | NA | VFGKEKVNEL | VFGKEKVNEL | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1162.65 +2 | NA | NA |
| FMDB409 | 25613046 | NA | NA | DVPSERYLGY | DVPSERYLGY | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1198.57 +2 | NA | NA |
| FMDB410 | 25613046 | NA | NA | DVPSERYLGY | DVPSERYLGY | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1198.57 +2 | NA | NA |
| FMDB411 | 25613046 | NA | NA | NSEKTTMPLW | NSEKTTMPLW | 10 | Skimmed bovine Milk | αS1-Casein | NA | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1206.58 +2 | NA | NA |
| FMDB412 | 25613046 | NA | NA | NSEKTTMPLW | NSEKTTMPLW | 10 | Skimmed bovine Milk | αS1-Casein | NA | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1206.58 +2 | NA | NA |
| FMDB413 | 25613046 | NA | NA | IVPNSAEERL S5 (phospho) | IVPNSAEERL | 11 | Skimmed bovine Milk | αS1-Casein | NA | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1207.57 +2 | NA | NA |
| FMDB414 | 25613046 | NA | NA | DQAMEDIKQM | DQAMEDIKQM | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1208.53 +2 | NA | NA |
| FMDB415 | 25613046 | NA | NA | DQAMEDIKQM | DQAMEDIKQM | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1208.53 +2 | NA | NA |
| FMDB416 | 25613046 | NA | NA | AQQKEPMIGVN | AQQKEPMIGVN | 11 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1214.62 +2 | NA | NA |
| FMDB417 | 25613046 | NA | NA | AQQKEPMIGVN | AQQKEPMIGVN | 11 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1214.62 +2 | NA | NA |
| FMDB418 | 25613046 | NA | NA | EIVPNSVEQK S6 (phospho) | EIVPNSVEQK | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1222.57 +2 | NA | NA |
| FMDB419 | 25613046 | NA | NA | EIVPNSAEER S6 (phospho) | EIVPNSAEER | 11 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1223.53 +2 | NA | NA |
| FMDB420 | 25613046 | NA | NA | AQQKEPMIGVN M7 (oxidation) | AQQKEPMIGVN | 12 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1230.61 +2 | NA | NA |
| FMDB421 | 25613046 | NA | NA | AQQKEPMIGVN M7 (oxidation) | AQQKEPMIGVN | 11 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1230.61 +2 | NA | NA |
| FMDB422 | 25613046 | NA | NA | KEDVPSERYL | KEDVPSERYL | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1235.63 +2 | NA | NA |
| FMDB423 | 25613046 | NA | NA | KEDVPSERYL | KEDVPSERYL | 10 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1235.63 +2 | NA | NA |
| FMDB424 | 25613046 | NA | NA | VFGKEKVNELS | VFGKEKVNELS | 11 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1249.68 +2 | NA | NA |
| FMDB425 | 25613046 | NA | NA | DIPNPIGSENSE | DIPNPIGSENSE | 12 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1271.58 +2 | NA | NA |
| FMDB426 | 25613046 | NA | NA | DIPNPIGSENSE | DIPNPIGSENSE | 12 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1271.58 +2 | NA | NA |
| FMDB427 | 25613046 | NA | NA | QKEPMIGVNQE | QKEPMIGVNQE | 11 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1272.63 +2 | NA | NA |
| FMDB428 | 25613046 | NA | NA | QKEPMIGVNQE | QKEPMIGVNQE | 11 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1272.63 +2 | NA | NA |
| FMDB429 | 25613046 | NA | NA | QKEPMIGVNQE | QKEPMIGVNQE | 11 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1288.62 +2 | NA | NA |
| FMDB430 | 25613046 | NA | NA | IVPNSAEERLH S5 (phospho) | IVPNSAEERLH | 12 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1344.63 +2 | NA | NA |
| FMDB431 | 25613046 | NA | NA | IVPNSAEERLH S5 (phospho) | IVPNSAEERLH | 12 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1344.63 +2 | NA | NA |
| FMDB432 | 25613046 | NA | NA | QKEPMIGVNQEL | QKEPMIGVNQEL | 12 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1385.71 +2 | NA | NA |
| FMDB433 | 25613046 | NA | NA | QKEPMIGVNQEL | QKEPMIGVNQEL | 12 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1385.71 +2 | NA | NA |
| FMDB434 | 25613046 | NA | NA | QKEPMIGVNQEL M5 (oxidation) | QKEPMIGVNQEL | 13 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1401.70 +2 | NA | NA |
| FMDB435 | 25613046 | NA | NA | QKEPMIGVNQEL M5 (oxidation) | QKEPMIGVNQEL | 13 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1401.70 +2 | NA | NA |
| FMDB436 | 25613046 | NA | NA | KVNELSKDIGSE S6 (phospho) S11 (phospho | KVNELSKDIGSE | 13 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1478.62 +2 | NA | NA |
| FMDB437 | 25613046 | NA | NA | SKDIGSESTEDQAM S8 (phospho) | SKDIGSESTEDQAM | 14 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1577.60 +2 | NA | NA |
| FMDB438 | 25613046 | NA | NA | QKEPMIGVNQELAY | QKEPMIGVNQELAY | 14 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1619.81 +2 | NA | NA |
| FMDB439 | 25613046 | NA | NA | SKDIGSESTEDQAM S6 (phospho) S8 (phospho | SKDIGSESTEDQAM | 15 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1657.57 +2 | NA | NA |
| FMDB440 | 25613046 | NA | NA | SKDIGSESTEDQAM S6 (phospho) S8 (phospho | SKDIGSESTEDQAM | 14 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Kefir grains (Lactobacilli, Lactococci, Leuconostoc & acetic acid bacteria,different yeasts) | NA | nano-UPLC-nano-ESI-MS/MS | 1657.57 +2 | NA | NA |
| FMDB441 | 25613046 | NA | NA | SKDIGSESTEDQAM S6 (phospho) S8 (phospho) M14 oxidation | SKDIGSESTEDQAM | 15 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1673.56 +2 | NA | NA |
| FMDB442 | 25613046 | NA | NA | SKDIGSESTEDQAME S8 (phospho) | SKDIGSESTEDQAME | 16 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1706.65 +2 | NA | NA |
| FMDB443 | 25613046 | NA | NA | SKDIGSESTEDQAME S6 (phospho) S8 (phospho) | SKDIGSESTEDQAME | 16 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1786.61 +2 | NA | NA |
| FMDB444 | 25613046 | NA | NA | KVNELSKDIGSESTE S11 (phospho) S13 (phospho) | KVNELSKDIGSESTE | 16 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1795.74 +2 | NA | NA |
| FMDB445 | 25613046 | NA | NA | SKDIGSESTEDQAME S6 (phospho) S8 (phospho) M14 oxidation | SKDIGSESTEDQAME | 16 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1802.61 +2 | NA | NA |
| FMDB446 | 25613046 | NA | NA | SVEQKHIQKEDVPSE S1 (phospho) | SVEQKHIQKEDVPSE | 16 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1832.84 +2 | NA | NA |
| FMDB447 | 25613046 | NA | NA | RPKHPIKHQGLPQEVL | RPKHPIKHQGLPQEVL | 16 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 1877.09 +3 | NA | NA |
| FMDB448 | 25613046 | NA | NA | RPKHPIKHQGLPQEVLNE | RPKHPIKHQGLPQEVLNE | 18 | Skimmed bovine Milk | αS1-Casein | 4.8 | 25C | NA | NA | NA | NA | NA | Starter culture (Lactococcus lactis ssp., Leuconostoc ssp. S. thermophilus, Lactobacillus ssp. Kefir yeast and kefir grain microflora) | NA | nano-UPLC-nano-ESI-MS/MS | 2120.17 +3 | NA | NA |
| FMDB734 | NA | NA | RPKQPIKHQGLPQ | RPKQPIKHQGLPQ | 13 | fermented Milk ( lassi) | αS1-Casein | 4.6 | 37C | 10h | Immunomodulatory;Anti-microbial | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1525.91 | NA | |
| FMDB735 | NA | NA | RPKQPIKHQGLPQGVL | RPKQPIKHQGLPQGVL | 16 | fermented Milk ( lassi) | αS1-Casein | 4.6 | 37C | 10h | Immunomodulatory;Anti-microbial | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1795.1 | NA | |
| FMDB736 | NA | NA | RPKQPIKHQGLPQG | RPKQPIKHQGLPQG | 14 | fermented Milk ( lassi) | αS1-Casein | 4.6 | 37C | 10h | Immunomodulatory;Anti-microbial | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1582.99 | NA | |
| FMDB737 | NA | NA | APFPEVFGK | APFPEVFGK | 9 | fermented Milk ( lassi) | αS1-Casein | 4.6 | 37C | 10h | NA | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 990.56 | NA | |
| FMDB738 | NA | NA | APFPEVFGKE | APFPEVFGKE | 10 | fermented Milk ( lassi) | αS1-Casein | 4.6 | 37C | 10h | NA | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1119.62 | NA | |
| FMDB739 | NA | NA | APFPEVFGKEKVNEL | APFPEVFGKEKVNEL | 15 | fermented Milk ( lassi) | αS1-Casein | 4.6 | 37C | 10h | Antioxidant | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1702.98 | NA | |
| FMDB783 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | RPKHPIKH YQKA | RPKHPIKH YQKA | 13 | fermented sheep Milk | αS1-Casein | NA | 37C | 18h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus Y10.13 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | NA | |
| FMDB784 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | RPKHPIKH | RPKHPIKH | 8 | sheep Milk Yogurt | αS1-Casein | 4.7 | 42C | 4h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | 40.3uM | |
| FMDB800 | 16162521 | NA | NA | LEIVPK | LEIVPK | 6 | caprine kefir | αS1-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 697.4 ± 0.06 | >1000 µM |
| FMDB803 | 16162521 | NA | NA | QLLKLK | QLLKLK | 6 | caprine kefir | αS1-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 741.5 ± 0.08 | 342.4 ± 32.1 µM |
| FMDB813 | 16162521 | NA | NA | ENLLRF | ENLLRF | 6 | caprine kefir | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 790.4 ± 0.06 | 82.4 ± 8.9 |
| FMDB862 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIKHQ | RPKHPIKHQ | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1140.7g/mol | 0.25mg/ml |
| FMDB863 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIK | RPKHPIK | 7 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 877g/mol | 0.25mg/ml |
| FMDB864 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPI | RPKHPI | 6 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 745.4g/mol | 0.25mg/ml |
| FMDB866 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | FVAPFPEVF | FVAPFPEVF | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1053.3g/mol | 0.11mg/ml |
| FMDB867 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | KKYKVPQLE | KKYKVPQLE | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1132.4g/mol | 0.11mg/ml |
| FMDB869 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIKHQ | RPKHPIKHQ | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1140.7g/mol | 0.18mg/ml |
| FMDB870 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIK | RPKHPIK | 7 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 877g/mol | 0.18mg/ml |
| FMDB871 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPI | RPKHPI | 6 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 745.4g/mol | 0.18mg/ml |
| FMDB873 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | FVAPFPEVF | FVAPFPEVF | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1053.3g/mol | 0.09mg/ml |
| FMDB874 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | KKYKVPQLE | KKYKVPQLE | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1132.4g/mol | 0.09mg/ml |
| FMDB876 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIKHQ | RPKHPIKHQ | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1140.7g/mol | 0.20mg/ml |
| FMDB877 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIK | RPKHPIK | 7 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 877g/mol | 0.20mg/ml |
| FMDB878 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPI | RPKHPI | 6 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 745.4g/mol | 0.20mg/ml |
| FMDB880 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | FVAPFPEVF | FVAPFPEVF | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1053.3g/mol | 0.12mg/ml |
| FMDB881 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | KKYKVPQLE | KKYKVPQLE | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1132.4g/mol | 0.12mg/ml |
| FMDB883 | 16517684 | NA | NA | IKHQGLPQE | IKHQGLPQE | 9 | sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Anti-microbial against Enterobacter sakazakii ATCC 12868;Escherichia coli DPC5063 | In vitro | NA | well diffusion assay | L. acidophilus DPC6026 | proteinase | MALDI-TOF-MS | 1049.177 | NA | MIC;0.05mM |
| FMDB884 | PMD16517684 | NA | NA | VLNENLLR | VLNENLLR | 8 | sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Anti-microbial against Enterobacter sakazakii ATCC 12868;Escherichia coli DPC5063 | In vitro | NA | well diffusion assay | L. acidophilus DPC6026 | proteinase | MALDI-TOF-MS | 970.119 | NA | MIC;0.22mM |
| FMDB885 | PMD16517684 | NA | NA | SDIPNPI G SENSEK | SDIPNPI G SENSEK | 16 | sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Anti-microbial against Enterobacter sakazakii ATCC 12868;Escherichia coli DPC5063 | In vitro | NA | well diffusion assay | L. acidophilus DPC6026 | proteinase | MALDI-TOF-MS | 1486.7 | NA | MIC;1.0mM |
| FMDB886 | 22642665 | NA | NA | IKHQGLPQE | IKHQGLPQE | 9 | sodium Caseinate | αS1-Casein | NA | 37c | 17h | Anti-microbial against Cronobacter sakazakii DPC 6440 | In vitro | NA | 96 well antimicrobial assay | Bacillus cereus | proteases | MALDI-TOF-MS | NA | 1049 Da | NA |
| FMDB887 | 22642665 | NA | NA | VLNENLLR | VLNENLLR | 8 | sodium Caseinate | αS1-Casein | NA | 37c | 17h | Anti-microbial against Cronobacter sakazakii DPC 6440 | In vitro | NA | 97 well antimicrobial assay | Bacillus cereus | proteases | MALDI-TOF-MS | NA | 970Da | NA |
| FMDB888 | 22642665 | NA | NA | IKHQGLPQE | IKHQGLPQE | 9 | sodium Caseinate | αS1-Casein | NA | 37c | 17h | Anti-microbial against Cronobacter sakazakii DPC 6440 | In vitro | NA | 98 well antimicrobial assay | Bacillus thuringiensis | proteases | MALDI-TOF-MS | NA | 1049 Da | NA |
| FMDB889 | 22642665 | NA | NA | VLNENLLR | VLNENLLR | 8 | sodium Caseinate | αS1-Casein | NA | 37c | 17h | Anti-microbial against Cronobacter sakazakii DPC 6440 | In vitro | NA | 99 well antimicrobial assay | Bacillus thuringiensis | proteases | MALDI-TOF-MS | NA | 970 Da | NA |
| FMDB894 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | KQMK | KQMK | 4 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 268.1+ 2 | 534.4 | NA |
| FMDB895 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | KKYNVPQ | KKYNVPQ | 7 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 438.7 +2 | 875.4 | NA |
| FMDB896 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | VPSERY | VPSERY | 6 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 375.7 +2 | 749.4 | NA |
| FMDB897 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | FPE | FPE | 3 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 392.1 +1 | 391.1 | NA |
| FMDB898 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | DVPSERY | DVPSERY | 7 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 433.1+ 2 | 864.4 | NA |
| FMDB904 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | DVPSERYLG | DVPSERYLG | 9 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 518.1+ 2 | 1035.3 | NA |
| FMDB905 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | VPSERYL | VPSERYL | 7 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 432.2 +2 | 862.3 | NA |
| FMDB906 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | LEIVPK | LEIVPK | 6 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 349.6+ 2 | 697.3 | NA |
| FMDB909 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | VVAPFPE | VVAPFPE | 7 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 758.1 +1 | 757.4 | NA |
| FMDB910 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | KKYNVPQL | KKYNVPQL | 8 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 495.3+ 2 | 988.4 | NA |
| FMDB947 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | PQEVL | PQEVL | 5 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 584.4 | NA |
| FMDB948 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | VLNENLL | VLNENLL | 7 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 813.5 | NA |
| FMDB958 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | NLLRF | NLLRF | 5 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 661.5 | NA |
| FMDB959 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | FVAPFPE | FVAPFPE | 7 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 805.4 | NA |
| FMDB960 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | FRQFYQL | FRQFYQL | 7 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1000.5 | NA |
| FMDB961 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | KTTMPLW | KTTMPLW | 7 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Ace-inhibitory;Immunomodulatory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 875.5 | 51 μM |
| FMDB971 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | VAPFPGVFGK | VAPFPGVFGK | 10 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1089.5 | 140 μM |
| FMDB972 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | VAPFPGVFGK | VAPFPGVFGK | 10 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1089.5 | NA |
| FMDB1065 | 17483275 | NA | NA | IGSENSEKTTMP | IGSENSEKTTMP | 12 | Bovine sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1308.53 | 773.10uM |
| FMDB1066 | 17483275 | NA | NA | KHIQKEDVPSER | KHIQKEDVPSER | 12 | Bovine sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1464.67 | NA |
| FMDB1068 | 17483275 | NA | NA | IQKEDVPSER | IQKEDVPSER | 10 | Bovine sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1199.53 | NA |
| FMDB1070 | 17483275 | NA | NA | LSKDIGSESTEDQAMED | LSKDIGSESTEDQAMED | 17 | Bovine sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 2029.57 | NA |
| FMDB1071 | 17483275 | NA | NA | IVPNSVEQKH | IVPNSVEQKH | 10 | Bovine sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1228.61 | NA |
| FMDB1080 | 27606488 | NA | NA | RPKHPIK | RPKHPIK | 7 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis | NA | MALDI-TOF/MS/MS | 875 | NA | NA |
| FMDB1081 | 27606488 | NA | NA | RPKHPIK | RPKHPIK | 7 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 875 | NA | NA |
| FMDB1082 | 27606488 | NA | NA | RPKHPIK | RPKHPIK | 7 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+adjunct culture Lb. fermentum H9 | NA | MALDI-TOF/MS/MS | 875 | NA | NA |
| FMDB1086 | 27606488 | NA | NA | VPSERYLG | VPSERYLG | 8 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis | NA | MALDI-TOF/MS/MS | 920 | NA | NA |
| FMDB1088 | 27606488 | NA | NA | APFPEVFGK | APFPEVFGK | 9 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis | NA | MALDI-TOF/MS/MS | 991 | NA | NA |
| FMDB1091 | 27606488 | NA | NA | RPKHPIKH | RPKHPIKH | 8 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis | NA | MALDI-TOF/MS/MS | 1012 | NA | NA |
| FMDB1092 | 27606488 | NA | NA | RPKHPIKH | RPKHPIKH | 8 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1012 | NA | NA |
| FMDB1093 | 27606488 | NA | NA | RPKHPIKH | RPKHPIKH | 8 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+adjunct culture Lb. fermentum H9 | NA | MALDI-TOF/MS/MS | 1012 | NA | NA |
| FMDB1095 | 27606488 | NA | NA | VPSERYLGY | VPSERYLGY | 9 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis | NA | MALDI-TOF/MS/MS | 1083 | NA | NA |
| FMDB1096 | 27606488 | NA | NA | VPSERYLGY | VPSERYLGY | 9 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1083 | NA | NA |
| FMDB1097 | 27606488 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis | NA | MALDI-TOF/MS/MS | 1140 | NA | NA |
| FMDB1098 | 27606488 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1140 | NA | NA |
| FMDB1099 | 27606488 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+adjunct culture Lb. fermentum H9 | NA | MALDI-TOF/MS/MS | 1140 | NA | NA |
| FMDB1100 | 27606488 | NA | NA | HPIKHQGLPQ | HPIKHQGLPQ | 10 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+adjunct culture Lb. fermentum H9 | NA | MALDI-TOF/MS/MS | 1154 | NA | NA |
| FMDB1101 | 27606488 | NA | NA | RPKHPIKHQG | RPKHPIKHQG | 10 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis | NA | MALDI-TOF/MS/MS | 1197 | NA | NA |
| FMDB1102 | 27606488 | NA | NA | APFPEVFGKEK | APFPEVFGKEK | 11 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis | NA | MALDI-TOF/MS/MS | 1248 | NA | NA |
| FMDB1106 | 27606488 | NA | NA | HPIKHQGLPQE | HPIKHQGLPQE | 11 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1283 | NA | NA |
| FMDB1109 | 27606488 | NA | NA | RPKHPIKHQGLP | RPKHPIKHQGLP | 12 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis | NA | MALDI-TOF/MS/MS | 1407 | NA | NA |
| FMDB1110 | 27606488 | NA | NA | RPKHPIKHQGLP | RPKHPIKHQGLP | 12 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1407 | NA | NA |
| FMDB1111 | 27606488 | NA | NA | RPKHPIKHQGLP | RPKHPIKHQGLP | 12 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+adjunct culture Lb. fermentum H9 | NA | MALDI-TOF/MS/MS | 1407 | NA | NA |
| FMDB1112 | 27606488 | NA | NA | RPKHPIKHQGLPQ | RPKHPIKHQGLPQ | 13 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis | NA | MALDI-TOF/MS/MS | 1535 | NA | NA |
| FMDB1113 | 27606488 | NA | NA | RPKHPIKHQGLPQ | RPKHPIKHQGLPQ | 13 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1535 | NA | NA |
| FMDB1114 | 27606488 | NA | NA | RPKHPIKHQGLPQ | RPKHPIKHQGLPQ | 13 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+adjunct culture Lb. fermentum H9 | NA | MALDI-TOF/MS/MS | 1535 | NA | NA |
| FMDB1116 | 27606488 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis | NA | MALDI-TOF/MS/MS | 1664 | NA | NA |
| FMDB1117 | 27606488 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1664 | NA | NA |
| FMDB1118 | 27606488 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+adjunct culture Lb. fermentum H9 | NA | MALDI-TOF/MS/MS | 1664 | NA | NA |
| FMDB1119 | 27606488 | NA | NA | RPKHPIKHQGLPQEV | RPKHPIKHQGLPQEV | 15 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1763 | NA | NA |
| FMDB1120 | 27606488 | NA | NA | RPKHPIKHQGLPQEVL | RPKHPIKHQGLPQEVL | 16 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct cultureLb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1876 | NA | NA |
| FMDB1124 | 27606488 | NA | NA | RPKHPIKHQGLPQEVLN | RPKHPIKHQGLPQEVLN | 17 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis | NA | MALDI-TOF/MS/MS | 1990 | NA | NA |
| FMDB1125 | 27606488 | NA | NA | RPKHPIKHQGLPQEVLN | RPKHPIKHQGLPQEVLN | 17 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct cultureLb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1990 | NA | NA |
| FMDB1126 | 27606488 | NA | NA | RPKHPIKHQGLPQEVLN | RPKHPIKHQGLPQEVLN | 17 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+adjunct culture Lb. fermentum H9 | NA | MALDI-TOF/MS/MS | 1990 | NA | NA |
| FMDB1127 | 27606488 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis | NA | MALDI-TOF/MS/MS | 2763 | NA | NA |
| FMDB1198 | NA | Influence of fermentation temperature and autolysis on ACE-inhibitory activity and peptide profiles of Milk fermented by selected strains of Lactobacillus helveticus and Lactococcus lactis | PQLEI | PQLEI | 5 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 600.4 | NA | |
| FMDB1199 | 10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 1140.9 | NA |
| FMDB1203 | 10908049 | NA | NA | FVAPFPQV | FVAPFPQV | 8 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 905.6 | NA |
| FMDB1219 | 10966406 | NA | NA | PQLEI | PQLEI | 5 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 600.4 | NA |
| FMDB1220 | 10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 1140.9 | NA |
| FMDB1224 | 10908049 | NA | NA | FVAPFPQV | FVAPFPQV | 8 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 905.6 | NA |
| FMDB1239 | 10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 1140.9 | NA |
| FMDB1240 | 10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 1140.9 | NA |
| FMDB1243 | 10908049 | NA | NA | RPKHPI | RPKHPI | 6 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 747.6 | NA |
| FMDB1246 | 10908049 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 1536.4 | NA |
| FMDB1291 | NA | li15 | NA | LRFF | LRFF | 4 | Fermented Milk (reconstituted skim Milk) | αS1-Casein | 4.3 | 32c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay By HPLC | Kluyveromyces marxianus Z17 | proteinase and peptidase | MALDI/TOF-TOF MS/MS | NA | NA | 116.9uM |
| FMDB1299 | NA | farvin10 | NA | PIGSENS | PIGSENS | 7 | fish oil enriched Yogurt | αS1-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 703.4 | NA |
| FMDB1309 | NA | farvin10 | NA | VFGKEKVNEL | VFGKEKVNEL | 10 | fish oil enriched Yogurt | αS1-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1162.7 | NA |
| FMDB1381 | 23845432 | NA | NA | LLRF | LLRF | 4 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA21 | NA | RP-HPLC–MS/MS | NA | 547.4 | 19.5ug protein/ml |
| FMDB1382 | 23845432 | NA | NA | LLRF | LLRF | 4 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA12 | NA | RP-HPLC–MS/MS | NA | 547.4 | 22.8ug protein/ml |
| FMDB1383 | 23845432 | NA | NA | LLRF | LLRF | 4 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis BCS27 | NA | RP-HPLC–MS/MS | NA | 547.4 | 28.4ug protein/ml |
| FMDB1384 | 23845432 | NA | NA | LGTQY | LGTQY | 5 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis H10 | NA | RP-HPLC–MS/MS | NA | 580.3 | 27.9ug protein/ml |
| FMDB1385 | 23845432 | NA | NA | FRQF | FRQF | 4 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 596.3 | 24.3ug protein/ml |
| FMDB1386 | 23845432 | NA | NA | RPKHP | RPKHP | 5 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 633.4 | 24.3ug protein/ml |
| FMDB1387 | 23845432 | NA | NA | FVAPFP | FVAPFP | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 676.4 | 24.3ug protein/ml |
| FMDB1388 | 23845432 | NA | NA | FVAPFP | FVAPFP | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 676.4 | 34.2ug protein/ml |
| FMDB1389 | 23845432 | NA | NA | FVAPFP | FVAPFP | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 676.4 | 25.9ug protein/ml |
| FMDB1390 | 23845432 | NA | NA | FVAPFP | FVAPFP | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis 3Er1 | NA | RP-HPLC–MS/MS | NA | 676.4 | 38.4ug protein/ml |
| FMDB1391 | 23845432 | NA | NA | FVAPFP | FVAPFP | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis H10 | NA | RP-HPLC–MS/MS | NA | 676.4 | 27.9ug protein/ml |
| FMDB1392 | 23845432 | NA | NA | LEIVPK | LEIVPK | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 683.4 | 25.9ug protein/ml |
| FMDB1393 | 23845432 | NA | NA | LEIVPK | LEIVPK | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis 3Er1 | NA | RP-HPLC–MS/MS | NA | 683.4 | 38.4ug protein/ml |
| FMDB1394 | 23845432 | NA | NA | LEIVPK | LEIVPK | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis H10 | NA | RP-HPLC–MS/MS | NA | 683.4 | 27.9ug protein/ml |
| FMDB1395 | 23845432 | NA | NA | VLNENL | VLNENL | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 700.4 | 34.2ug protein/ml |
| FMDB1396 | 23845432 | NA | NA | VLNENL | VLNENL | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 700.4 | 25.9ug protein/ml |
| FMDB1397 | 23845432 | NA | NA | VLNENL | VLNENL | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis 3Er1 | NA | RP-HPLC–MS/MS | NA | 700.4 | 38.4ug protein/ml |
| FMDB1398 | 23845432 | NA | NA | VLNENL | VLNENL | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis H10 | NA | RP-HPLC–MS/MS | NA | 700.4 | 27.9ug protein/ml |
| FMDB1399 | 23845432 | NA | NA | LHSMKEG | LHSMKEG | 7 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 800.3 | 34.2ug protein/ml |
| FMDB1400 | 23845432 | NA | NA | FPEVFGK | FPEVFGK | 7 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 822.4 | 24.3ug protein/ml |
| FMDB1401 | 23845432 | NA | NA | IPNPIGSE | IPNPIGSE | 8 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 825.6 | 24.3ug protein/ml |
| FMDB1543 | 23845432 | NA | NA | LLRF | LLRF | 4 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis BCS27 | NA | RP-HPLC–MS/MS | NA | 547.4 | 28.4ug protein/ml |
| FMDB1544 | 23845432 | NA | NA | LLRF | LLRF | 4 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA12 | NA | RP-HPLC–MS/MS | NA | 547.4 | 22.8ug protein/ml |
| FMDB1545 | 23845432 | NA | NA | LLRF | LLRF | 4 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA21 | NA | RP-HPLC–MS/MS | NA | 547.4 | 19.5ug protein/ml |
| FMDB1546 | 23845432 | NA | NA | RPKHP | RPKHP | 5 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis BCS27 | NA | RP-HPLC–MS/MS | NA | 633.4 | 28.4ug protein/ml |
| FMDB1547 | 23845432 | NA | NA | RPKHP | RPKHP | 5 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis CGV67 | NA | RP-HPLC–MS/MS | NA | 633.4 | 24.9ug protein/ml |
| FMDB1548 | 23845432 | NA | NA | RPKHP | RPKHP | 5 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 633.4 | 23.8ug protein/ml |
| FMDB1549 | 23845432 | NA | NA | RPKHP | RPKHP | 5 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis QM38 | NA | RP-HPLC–MS/MS | NA | 633.4 | 17.8ug protein/ml |
| FMDB1550 | 23845432 | NA | NA | RPKHP | RPKHP | 5 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis SMF54. | NA | RP-HPLC–MS/MS | NA | 633.4 | 27.3ug protein/ml |
| FMDB1551 | 23845432 | NA | NA | VFGKEK | VFGKEK | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis BCS27 | NA | RP-HPLC–MS/MS | NA | 706.3 | 28.4ug protein/ml |
| FMDB1552 | 23845432 | NA | NA | VFGKEK | VFGKEK | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis CGV67 | NA | RP-HPLC–MS/MS | NA | 706.3 | 24.9ug protein/ml |
| FMDB1553 | 23845432 | NA | NA | VFGKEK | VFGKEK | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis SMF54. | NA | RP-HPLC–MS/MS | NA | 706.3 | 27.3ug protein/ml |
| FMDB1554 | 23845432 | NA | NA | LHSMKEG | LHSMKEG | 7 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis BCS27 | NA | RP-HPLC–MS/MS | NA | 800.3 | 28.4ug protein/ml |
| FMDB1555 | 23845432 | NA | NA | LHSMKEG | LHSMKEG | 7 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis BCS53 | NA | RP-HPLC–MS/MS | NA | 800.3 | 26.3ug protein/ml |
| FMDB1556 | 23845432 | NA | NA | LHSMKEG | LHSMKEG | 7 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis CECT184 | NA | RP-HPLC–MS/MS | NA | 800.3 | 16.1ug protein/ml |
| FMDB1557 | 23845432 | NA | NA | LHSMKEG | LHSMKEG | 7 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis LG101 | NA | RP-HPLC–MS/MS | NA | 800.3 | 16.1ug protein/ml |
| FMDB1558 | 23845432 | NA | NA | LHSMKEG | LHSMKEG | 7 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis QA12 | NA | RP-HPLC–MS/MS | NA | 800.3 | 22.8ug protein/ml |
| FMDB1559 | 23845432 | NA | NA | LHSMKEG | LHSMKEG | 7 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis QA21 | NA | RP-HPLC–MS/MS | NA | 800.3 | 19.5ug protein/ml |
| FMDB1560 | 23845432 | NA | NA | LHSMKEG | LHSMKEG | 7 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 800.3 | 24.8ug protein/ml |
| FMDB1561 | 23845432 | NA | NA | LHSMKEG | LHSMKEG | 7 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis QA127 | NA | RP-HPLC–MS/MS | NA | 800.3 | 20.8ug protein/ml |
| FMDB1562 | 23845432 | NA | NA | LHSMKEG | LHSMKEG | 7 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis QF386 | NA | RP-HPLC–MS/MS | NA | 800.3 | 21.4ug protein/ml |
| FMDB1563 | 23845432 | NA | NA | LHSMKEG | LHSMKEG | 7 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis QM38 | NA | RP-HPLC–MS/MS | NA | 800.3 | 17.8ug protein/ml |
| FMDB1564 | 23845432 | NA | NA | IHAQQKEP | IHAQQKEP | 8 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis BCS27 | NA | RP-HPLC–MS/MS | NA | 949.4 | 28.4ug protein/ml |
| FMDB1565 | 23845432 | NA | NA | IHAQQKEP | IHAQQKEP | 8 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis LG101 | NA | RP-HPLC–MS/MS | NA | 949.4 | 16.1ug protein/ml |
| FMDB1566 | 23845432 | NA | NA | IHAQQKEP | IHAQQKEP | 8 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis QA21 | NA | RP-HPLC–MS/MS | NA | 949.4 | 19.5ug protein/ml |
| FMDB1567 | 23845432 | NA | NA | IHAQQKEP | IHAQQKEP | 8 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 949.4 | 24.8ug protein/ml |
| FMDB1568 | 23845432 | NA | NA | IHAQQKEP | IHAQQKEP | 8 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis QA127 | NA | RP-HPLC–MS/MS | NA | 949.4 | 20.8ug protein/ml |
| FMDB1569 | 23845432 | NA | NA | IHAQQKEP | IHAQQKEP | 8 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis QF386 | NA | RP-HPLC–MS/MS | NA | 949.4 | 21.4ug protein/ml |
| FMDB1570 | 23845432 | NA | NA | IHAQQKEP | IHAQQKEP | 8 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis QM38 | NA | RP-HPLC–MS/MS | NA | 949.4 | 17.8ug protein/ml |
| FMDB1571 | 23845432 | NA | NA | LKKYKVPQ | LKKYKVPQ | 8 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis BCS27 | NA | RP-HPLC–MS/MS | NA | 1002.5 | 28.4ug protein/ml |
| FMDB1572 | 23845432 | NA | NA | LKKYKVPQ | LKKYKVPQ | 8 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis QA21 | NA | RP-HPLC–MS/MS | NA | 1002.5 | 19.5ug protein/ml |
| FMDB1573 | 23845432 | NA | NA | LKKYKVPQ | LKKYKVPQ | 8 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | NA | NA | NA | NA | E. faecalis QA127 | NA | RP-HPLC–MS/MS | NA | 1002.5 | 20.8ug protein/ml |
| FMDB1583 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | TDAPSFSDIPNPIGSENSGK | TDAPSFSDIPNPIGSENSGK | 20 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1016.976+2 | 2031.95 | NA |
| FMDB1584 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | DIPNPIGSENSGKTTMPLW | DIPNPIGSENSGKTTMPLW | 19 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1028.993+2 | 2055.98 | NA |
| FMDB1585 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | IPNPIGSENSGKIT | IPNPIGSENSGKIT | 14 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 713.872 +2 | 1425.74 | NA |
| FMDB1591 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | RPK | RPK | 3 | WSE of commercial goat cheese | αS1-Casein | NA | NA | 2month old | NA | NA | NA | NA | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 400.2 | NA |
| FMDB1604 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | ENLL | ENLL | 4 | WSE of commercial mahon cheese ( cow Milk) | αS1-Casein | NA | NA | After 2months ripening | NA | NA | NA | NA | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 488.1 | NA |
| FMDB1605 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | EVLN | EVLN | 4 | WSE of commercial mahon cheese ( cow Milk) | αS1-Casein | NA | NA | After 2months ripening | NA | NA | NA | NA | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 474.1 | NA |
| FMDB1606 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | PQEVL | PQEVL | 5 | WSE of commercial mahon cheese ( cow Milk) | αS1-Casein | NA | NA | After 2months ripening | NA | NA | NA | NA | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 585.2 | NA |
| FMDB1607 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | NENLL | NENLL | 5 | WSE of commercial mahon cheese ( cow Milk) | αS1-Casein | NA | NA | After 2months ripening | NA | NA | NA | NA | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 602.2 | NA |
| FMDB1608 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | NLLRF | NLLRF | 5 | WSE of commercial mahon cheese ( cow Milk) | αS1-Casein | NA | NA | After 2months ripening | NA | NA | NA | NA | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 662.3 | NA |
| FMDB1620 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | HPIK | HPIK | 4 | WSE of commercial manchego cheese ( ewe's Milk) | αS1-Casein | NA | NA | 4month old | NA | NA | NA | NA | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 494.2 | NA |
| FMDB1621 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | HQGL | HQGL | 4 | WSE of commercial manchego cheese ( ewe's Milk) | αS1-Casein | NA | NA | 4month old | NA | NA | NA | NA | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 454.2 | NA |
| FMDB1631 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | HPIK | HPIK | 4 | WSE of roncal cheese | αS1-Casein | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 494.2 | NA |
| FMDB1632 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | HQGL | HQGL | 4 | WSE of roncal cheese | αS1-Casein | NA | NA | 4month old | NA | NA | NA | NA | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 454.2 | NA |
| FMDB1636 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | PKHP | PKHP | 4 | WSE of roncal cheese | αS1-Casein | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 478.2 | 709.1µM |
| FMDB1637 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | RPKHP | RPKHP | 5 | WSE of roncal cheese | αS1-Casein | NA | NA | 4month old | NA | NA | NA | NA | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 634.3 | NA |
| FMDB1640 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | PQL | PQL | 3 | WSE of Idiaz´abal cheese ( Ovine Milk) | αS1-Casein | NA | NA | 4month old | NA | NA | NA | NA | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 357.1 | NA |
| FMDB1641 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | AWY | AWY | 3 | WSE of Idiaz´abal cheese ( Ovine Milk) | αS1-Casein | NA | NA | 4month old | NA | NA | NA | NA | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 439 | NA |
| FMDB1642 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | PSE | PSE | 3 | WSE of Idiaz´abal cheese ( Ovine Milk) | αS1-Casein | NA | NA | 4month old | NA | NA | NA | NA | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 332.1 | NA |
| FMDB1643 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | NINE | NINE | 4 | WSE of Idiaz´abal cheese ( Ovine Milk) | αS1-Casein | NA | NA | 4month old | NA | NA | NA | NA | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 489.1 | NA |
| FMDB1644 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | ERYL | ERYL | 4 | WSE of Idiaz´abal cheese ( Ovine Milk) | αS1-Casein | NA | NA | 4month old | NA | NA | NA | NA | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 580.2 | NA |
| FMDB1646 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | EIVPK | EIVPK | 5 | WSE of Idiaz´abal cheese ( Ovine Milk) | αS1-Casein | NA | NA | 4month old | NA | NA | NA | NA | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 585.3 | NA |
| FMDB1649 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | RFVVAPFPE | RFVVAPFPE | 9 | WSE of Pecorino Romano cheese | Sheep αS1-Casein | 5.3 | 45-46C cooking ; ripenin 10mo | 10monthold | Antibacterial | In vitro | NA | NA | natural culture in scotta | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1061.7 | NA | |
| FMDB1650 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | VVAPFPEV | VVAPFPEV | 8 | WSE of Pecorino Romano cheese | Sheep αS1-Casein | 5.3 | 45-46C cooking ; ripenin 10mo | 10monthold | Antibacterial | In vitro | NA | NA | natural culture in scotta | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 857.5 | NA | |
| FMDB1655 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | FVAPFPEVFG | FVAPFPEVFG | 10 | WSE of Canestrato Pugliese | cow αS1-Casein | 5 | NA | 6month old ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Whey culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1109.5 | NA | |
| FMDB1656 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | GKEKVNELSKD | GKEKVNELSKD | 11 | WSE of Canestrato Pugliese cheese | cow αS1-Casein | 5 | NA | 6month old ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Whey culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1246.7 | NA | |
| FMDB1657 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | FVAPFPEVFG | FVAPFPEVFG | 10 | WSE of Canestrato Pugliese cheese | cow αS1-Casein | 5 | NA | 6month old ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Whey culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1109.5 | NA | |
| FMDB1658 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | RPKHPIK | RPKHPIK | 7 | WSE of Caciocavallo | cow αS1-Casein | 5.2 | stretching at 90-95C | 3 monthold ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Milk culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 875.6 | NA | |
| FMDB1659 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | GLPQE | GLPQE | 5 | WSE of Caciocavallo cheese | cow αS1-Casein | 5.2 | stretching at 90-95C | 4 monthold ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Milk culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 543.1 | NA | |
| FMDB1663 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | FVAPFPEVFG | FVAPFPEVFG | 10 | WSE of Crescenza cheese | cow αS1-Casein | 5.6 | NA | 7days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | freeze dried culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1109.4 | NA | |
| FMDB1664 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | FVAPFPEVF | FVAPFPEVF | 9 | WSE of Crescenza cheese | cow αS1-Casein | 5.6 | NA | 7days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | freeze dried culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1052.7 | NA | |
| FMDB1668 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | VVAPFPE | VVAPFPE | 7 | WSE of Caprino del piemonte cheese | Goat αS1-Casein | 4.7 | NA | 30days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | NA | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 758.4 | NA | |
| FMDB1784 | 26616950;17483270 | NA | NA | VLNENLLR | VLNENLLR | 8 | Casein (raw Milk) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1785 | 26616950; 17483270 | NA | NA | VLNENLLR | VLNENLLR | 8 | Casein (Heat treated Milk with open vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1786 | 26616950; 17483271 | NA | NA | VLNENLLR | VLNENLLR | 8 | Casein (Heat treated Milk with closed vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1787 | 26616950; 17483272 | NA | NA | VLNENLLR | VLNENLLR | 8 | Casein (Kefir) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1796 | 26616950; 17483281 | NA | NA | IGSENSEKTTMP | IGSENSEKTTMP | 12 | Casein (raw Milk) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1797 | 26616950; 17483282 | NA | NA | IGSENSEKTTMP | IGSENSEKTTMP | 12 | Casein (Heat treated Milk with open vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1798 | 26616950; 17483283 | NA | NA | IGSENSEKTTMP | IGSENSEKTTMP | 12 | Casein (Heat treated Milk with closed vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1810 | 26616950 | NA | NA | VAPFPEVF | VAPFPEVF | 8 | Casein (raw Milk) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1811 | 26616950 | NA | NA | VAPFPEVF | VAPFPEVF | 8 | Casein (Heat treated Milk with open vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1812 | 26616950 | NA | NA | VAPFPEVF | VAPFPEVF | 8 | Casein (Heat treated Milk with closed vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1813 | 26616950 | NA | NA | VAPFPEVF | VAPFPEVF | 8 | Casein (Kefir) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1814 | 26616950 | NA | NA | FVAPFPEV | FVAPFPEV | 8 | Casein (raw Milk) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1815 | 26616950 | NA | NA | FVAPFPEV | FVAPFPEV | 8 | Casein (Heat treated Milk with open vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1816 | 26616950 | NA | NA | FVAPFPEV | FVAPFPEV | 8 | Casein (Heat treated Milk with closed vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1817 | 26616950 | NA | NA | FVAPFPEV | FVAPFPEV | 8 | Casein (Kefir) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1820 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | FVAPFPE | FVAPFPE | 7 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 806.388+1 | 805.372 | NA |
| FMDB1821 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VAPFP | VAPFP | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 530.179+1 | 529.172 | NA |
| FMDB1822 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VAPFPE | VAPFPE | 6 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 659.312+1 | 658.304 | NA |
| FMDB1823 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | FGKEK | FGKEK | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 608.373+1 | 607.366 | NA |
| FMDB1824 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | EKVNE | EKVNE | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 618.394+1 | 617.387 | NA |
| FMDB1825 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | IQKED | IQKED | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 632.362+1 | 631.354 | NA |
| FMDB1826 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LEQL | LEQL | 4 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 502.15+1 | 501.143 | NA |
| FMDB1827 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | IHAQ | IHAQ | 4 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 468.196+1 | 467.189 | NA |
| FMDB1828 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VNQEL | VNQEL | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 602.321+1 | 601.313 | NA |
| FMDB1829 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | YPSGAW | YPSGAW | 6 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 680.309+1 | 679.302 | NA |
| FMDB1830 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | PSGAW | PSGAW | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 517.184+1 | 516.177 | NA |
| FMDB1831 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VPLGTQY | VPLGTQY | 7 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 777.435+1 | 776.428 | NA |
| FMDB1832 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LGTQY | LGTQY | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 581.257+1 | 580.25 | NA |
| FMDB1833 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | DIPNP | DIPNP | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 555.344+1 | 554.337 | NA |
| FMDB1834 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | IGSEN | IGSEN | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 519.164+1 | 518.156 | NA |
| FMDB1857 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | FVAPFPE | FVAPFPE | 7 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 805.399+1 | 805.378 | NA |
| FMDB1858 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | PEVFGK | PEVFGK | 6 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 676.407 | 675.4 | NA |
| FMDB1859 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VFGKEK | VFGKEK | 6 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 707.446 | 706.439 | NA |
| FMDB1860 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | MEDIKQ | MEDIKQ | 6 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 763.321 | 762.322 | NA |
| FMDB1861 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | EDIKQ | EDIKQ | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 732.394 | 631.328 | NA |
| FMDB1862 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | MIGVNQEL | MIGVNQEL | 8 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 903.472 | 902.465 | NA |
| FMDB1863 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | PSGAW | PSGAW | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 517.171 | 516.164 | NA |
| FMDB1864 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | FSDIPNP | FSDIPNP | 7 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 789.371 | 788.634 | NA |
| FMDB1865 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | NPIGSEN | NPIGSEN | 7 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 730.385 | 729.314 | NA |
| FMDB2066 | 12957917 | NA | NA | FVAPFPEVFGKEKVNELSKDIGSE | FVAPFPEVFGKEKVNELSKDIGSE | 24 | Bovine Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 2194.35 | 57.2ug/ml |
| FMDB2067 | 12957917 | NA | NA | LGTQYTDAPSFSDIPNPIGSENSEK | LGTQYTDAPSFSDIPNPIGSENSEK | 25 | Bovine Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 2122.27 | 57.2ug/ml |
| FMDB2069 | 12957917 | NA | NA | FVAPFPEVFGKEKVNELSKDIGSE | FVAPFPEVFGKEKVNELSKDIGSE | 24 | Bovine Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 2194.35 | 16.2ug/ml |
| FMDB2071 | 12957917 | NA | NA | RPKHPI | RPKHPI | 6 | sheep Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 746.9 | 120.2ug/ml |
| FMDB2072 | 12957917 | NA | NA | RPKH | RPKH | 4 | sheep Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 537.32 | 120.2ug/ml |
| FMDB2073 | 12957917 | NA | NA | HPIKH | HPIKH | 5 | sheep Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 631.37 | 120.2ug/ml |
| FMDB2105 | 23871374 | NA | NA | HQGLPQEVLNENLLRF | HQGLPQEVLNENLLRF | 16 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 636.3389+3 | 1905.995 | NA |
| FMDB2106 | 23871374 | NA | NA | HQGLPQEVLNENLLR | HQGLPQEVLNENLLR | 15 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 587.3146+3 | 1758.9219 | NA |
| FMDB2107 | 23871374 | NA | NA | GLPQEVLNENLLRF | GLPQEVLNENLLRF | 14 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 821.4382+2 | 1640.8618 | NA |
| FMDB2108 | 23871374 | NA | NA | GLPQEVLNENLLR | GLPQEVLNENLLR | 13 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 747.9074+2 | 1493.8003 | NA |
| FMDB2109 | 23871374 | NA | NA | LPQEVLNENLLRF | LPQEVLNENLLRF | 13 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 792.9267+2 | 1583.8389 | NA |
| FMDB2110 | 23871374 | NA | NA | LPQEVLNENLLR | LPQEVLNENLLR | 12 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 719.3941+2 | 1436.7737 | NA |
| FMDB2111 | 23871374 | NA | NA | PQEVLNENLLR | PQEVLNENLLR | 11 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 662.8528+2 | 1323.691 | NA |
| FMDB2112 | 23871374 | NA | NA | EVLNENLLRF | EVLNENLLRF | 10 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 623.8431+2 | 1245.6467 | NA |
| FMDB2113 | 23871374 | NA | NA | VLNENLLRF | VLNENLLRF | 9 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 559.3113+2 | 1116.608 | NA |
| FMDB2114 | 23871374 | NA | NA | FVAPFPEVFGKEK | FVAPFPEVFGKEK | 13 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 498.9325+3 | 1493.7756 | NA |
| FMDB2115 | 23871374 | NA | NA | FVAPFPEVFGKE | FVAPFPEVFGKE | 12 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 683.8444+2 | 1365.6743 | NA |
| FMDB2116 | 23871374 | NA | NA | FSDIPNPIGSENSEKTTMPLW | FSDIPNPIGSENSEKTTMPLW | 21 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 793.7063+3 | 2378.0972 | NA |
| FMDB2120 | NA | NA | NA | HIQKEDVPSER | HIQKEDVPSER | 11 | Cheddar cheese | αS1-Casein | NA | NA | NA | Antioxidant | In vitro | NA | NA | Lactobacillus casei ssp. casei 300 | NA | LC-MS/MS | NA | 1336.7034 | NA |
| FMDB2140 | NA | schieber00 | Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of Rat | FVAPFPE | FVAPFPE | 7 | Yogurt | αS1-Casein | 4.9 | 44c | 3h | NA | NA | NA | NA | Streptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricus | NA | HPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptide | NA | 805.9g/mol | NA |
| FMDB2145 | NA | schieber00 | Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of Rat | VAPFPEVF | VAPFPEVF | 8 | Yogurt | αS1-Casein | 4.9 | 44c | 3h | NA | NA | NA | NA | Streptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricus | NA | HPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptide | NA | 905.1g/mol | NA |
| FMDB2147 | NA | schieber00 | Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of Rat | FVAPFPEVFG | FVAPFPEVFG | 10 | Yogurt | αS1-Casein | 4.9 | 44c | 3h | NA | NA | NA | NA | Streptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricus | NA | HPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptide | NA | 1109.3g/mol | NA |
| FMDB2155 | 15537298 | NA | NA | RPKHPI | RPKHPI | 6 | sodium Caseinate | αS1-Casein | NA | 37C | 1 and 2h | NA | NA | NA | NA | Lactobacillus (Lb.) helveticus NCC 2765 | NA | ESI-MS/ MS | NA | 747.8 da | >1000 uM |
| FMDB2164 | 15537298 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | sodium Caseinate | αS1-Casein | NA | 37C | 1 and 2h | NA | NA | NA | NA | Lactobacillus (Lb.) helveticus NCC 2765 | NA | ESI-MS/ MS | NA | 1140.7 da | >1000uM |
| FMDB2172 | 15537298 | NA | NA | FVAPFPEVFGKEKVNELSKDIGS | FVAPFPEVFGKEKVNELSKDIGS | 23 | sodium Caseinate | αS1-Casein | NA | 37C | 1 and 2h | Ace-inhibitory | In vitro | NA | spectrophotometric method using FAPGG as substrate | Lactobacillus (Lb.) helveticus NCC 2765 | NA | ESI-MS/ MS | NA | 2538.9 da | NA |
| FMDB2173 | 15537298 | NA | NA | NENLLRFFVAPFPE | NENLLRFFVAPFPE | 14 | sodium Caseinate | αS1-Casein | NA | 37C | 1 and 2h | Ace-inhibitory | In vitro | NA | spectrophotometric method using FAPGG as substrate | Lactobacillus (Lb.) helveticus NCC 2765 | NA | ESI-MS/ MS | NA | 1692.8 da | 55uM |