Fermented Food Database
This is the result page of browse. This page gives the information about peptides returned against the selected category. Further details of the peptide can be seen by clicking on the FMDB_ID. Further the user can sort the peptides on the basis of various fields by clicking on the respective headers.
The total number entries retrieved from this search are 204| FMDB_ID | PubMed ID | Reference | Title | Peptide_Sequence | Sequence | Length of peptide | Food_Matrix | Protein | pH | Temperature | Incubation Time | Activity | Experiment | Model | Assay for Activity Measurement | Culture | Hydrolysis | Method of analysis | M_Z ratio | Mass | IC50 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| FMDB5 | 8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | proteases | NA | NA | NA | 4uM |
| FMDB6 | 8201050 | NA | NA | GPFPIIV | GPFPIIV | 7 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | proteases | NA | NA | NA | 4uM |
| FMDB7 | 8201050 | NA | NA | GTQYTDAPSFSDIPNPIGSENSEKTTMPLW | GTQYTDAPSFSDIPNPIGSENSEKTTMPLW | 30 | Milk | αS1-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 346uM |
| FMDB8 | 8201050 | NA | NA | KYPVQPFTESQSLTL | KYPVQPFTESQSLTL | 15 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 93uM |
| FMDB9 | 8201050 | NA | NA | SVLSLSESKVLPVPE | SVLSLSESKVLPVPE | 15 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 39uM |
| FMDB10 | 8201050 | NA | NA | PPQSVLSLSESKVLPVPE | PPQSVLSLSESKVLPVPE | 18 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 25uM |
| FMDB11 | 8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 209uM |
| FMDB12 | 8201050 | NA | NA | YQQPVLGPVRGPFPIIV | YQQPVLGPVRGPFPIIV | 17 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 101uM |
| FMDB13 | 8201050 | NA | NA | LPQNIPPLTQTPVVVPPFLQPEVMGVSK | LPQNIPPLTQTPVVVPPFLQPEVMGVSK | 28 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 144uM |
| FMDB14 | 8201050 | NA | NA | LLYQQPVLGPVRGPFPIIV | LLYQQPVLGPVRGPFPIIV | 19 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 21uM |
| FMDB15 | 8201050 | NA | NA | DELQDKIHPFATQSLVYPFPGPIHNS | DELQDKIHPFATQSLVYPFPGPIHNS | 26 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 4uM |
| FMDB16 | 8201050 | NA | NA | AVPYPQR | AVPYPQR | 7 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 15uM |
| FMDB17 | 12369200 | NA | NA | IPP | IPP | 3 | calpis sour Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus and Saccharomyces cerevisiae | Proteinase | NA | NA | NA | 5 micro mol /l |
| FMDB18 | 12369200 | NA | NA | IPP | IPP | 3 | calpis sour Milk | k-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus and Saccharomyces cerevisiae | Proteinase | NA | NA | NA | 5 micro mol /l |
| FMDB19 | 12369200 | NA | NA | VPP | VPP | 3 | calpis sour Milk | bovine β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus and Saccharomyces cerevisiae | Proteinase | NA | NA | NA | 9micromol/l |
| FMDB20 | 7673515 | NA | NA | VPP | VPP | 3 | Skim Milk | β-Casein | 4.2 | 37C | 8-10h | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus LBK16H and Saccharomyces cerevisae | proteinase | NA | NA | NA | NA |
| FMDB21 | 7673515 | NA | NA | IPP | IPP | 3 | Skim Milk | β-Casein | 4.2 | 37C | 8-10h | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus LBK16H and Saccharomyces cerevisae | proteinase | NA | NA | NA | NA |
| FMDB22 | 7673515 | NA | NA | IPP | IPP | 3 | Skim Milk | k-Casein | 4.2 | 37C | 8-10h | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus LBK16H and Saccharomyces cerevisae | proteinase | NA | NA | NA | NA |
| FMDB31 | 25222748 | NA | NA | DVWY | DVWY | 4 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 582.5 | 0.69±0.04 mM |
| FMDB32 | 25222748 | NA | NA | FDART | FDART | 5 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 609.6 | 1.9±0.1 mM |
| FMDB33 | 25222748 | NA | NA | FQ | FQ | 2 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 294.2 | 7.4±0.6 mM |
| FMDB34 | 25222748 | NA | NA | VAE | VAE | 3 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 318 | 55.9±1.9 mM |
| FMDB35 | 25222748 | NA | NA | VVG | VVG | 3 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 274.2 | 39.6±5.7 mM |
| FMDB36 | 25222748 | NA | NA | WTFR | WTFR | 4 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 609.5 | 6.7±0.5 mM |
| FMDB39 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | DDQNPH | DDQNPH | 6 | Milk | α-LA | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 723.9 | 0.05ug/ml |
| FMDB40 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | LDDDLTDDI | LDDDLTDDI | 9 | Milk | α-LA | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1032.8 | 0.05ug/ml |
| FMDB41 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | YPSYGL | YPSYGL | 6 | Milk | k-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 698.6 | NA |
| FMDB42 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | HPHPHLSFMAIPP | HPHPHLSFMAIPP | 13 | Milk | k-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1479 | NA |
| FMDB43 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | YDTQAIVQ | YDTQAIVQ | 8 | Milk | α-LA | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1035.7 | NA |
| FMDB44 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | DDDLTDDIMCV | DDDLTDDIMCV | 11 | Milk | α-LA | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1386.8 | NA |
| FMDB45 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | YPSYG | YPSYG | 5 | Milk | k-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 585.9 | NA |
| FMDB46 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | AESIS | AESIS | 5 | Milk | AlphaSI-CN | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 505.9 | NA |
| FMDB47 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | SITRINK | SITRINK | 7 | Milk | β-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 830.1 | NA |
| FMDB48 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | HIQKEDVPS | HIQKEDVPS | 9 | Milk | AlphaSI-CN | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1051.4 | NA |
| FMDB49 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | TVQVTSTAV | TVQVTSTAV | 9 | Milk | k-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 904.1 | NA |
| FMDB50 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | NAVPITPTLN | NAVPITPTLN | 10 | Milk | αS2-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1038.4 | NA |
| FMDB51 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | SLPQNIPPL | SLPQNIPPL | 9 | Milk | β-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 977.1 | NA |
| FMDB52 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | QEPVLGPVRGPFPIIV | QEPVLGPVRGPFPIIV | 16 | Milk | β-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1716.9 | NA |
| FMDB53 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Milk | β-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1150.4 | NA |
| FMDB54 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | YIPIQYVLS | YIPIQYVLS | 9 | Milk | k-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1094.4 | NA |
| FMDB55 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | TVQVTSTAV | TVQVTSTAV | 9 | Milk | k-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 904.4 | NA |
| FMDB56 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | PEINTVQVTSTAV | PEINTVQVTSTAV | 13 | Milk | k-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1356.7 | NA |
| FMDB57 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | GYLAVA | GYLAVA | 6 | Milk | Serotransferrin | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 591.8 | NA |
| FMDB58 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | DVENLHLPLPLL | DVENLHLPLPLL | 12 | Milk | β-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50572 | NA | LC-MS | NA | 1371.53 | NA |
| FMDB59 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | YPSYGL | YPSYGL | 6 | Milk | β-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50572 | NA | LC-MS | NA | 698.6 | NA |
| FMDB60 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | ENGEC | ENGEC | 5 | Milk | b-lactoglobulin | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50572 | NA | LC-MS | NA | 549.8 | NA |
| FMDB61 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | TVQVTSTAV | TVQVTSTAV | 9 | Milk | k-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50572 | NA | LC-MS | NA | 904.2 | NA |
| FMDB62 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Milk | β-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50572 | NA | LC-MS | NA | 1150.5 | NA |
| FMDB63 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | TDDIMCVK | TDDIMCVK | 8 | Milk | α-LA | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50572 | NA | LC-MS | NA | 922 4 | NA |
| FMDB111 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB112 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB113 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB114 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB178 | NA | pan05 | Antihypertensive peptides from skimmed Milk hydrolysate digested by cell-free extract of Lactobacillus helveticus JCM1004 | VPP | VPP | 3 | Skimmed Milk | β-Casein &k Casein | 6.5-7.0 | 37c | 20h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substarte | Lactobacillus helveticus JCM1004 | proteinase and peptidase | RPHPLC and protein sequencer | NA | NA | 9.13 ± 0.21 uM |
| FMDB179 | NA | pan05 | NA | IPP | IPP | 3 | Skimmed Milk | β-Casein &k Casein | 6.5-7.0 | 37c | 20h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substarte | Lactobacillus helveticus JCM1004 | proteinase and peptidase | RPHPLC and protein sequencer | NA | NA | 5.15 ± 0.17 UM |
| FMDB182 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | LPP | LPP | 3 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB187 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | SPVVPFTE | SPVVPFTE | 8 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB188 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | LHLPLPL | LHLPLPL | 7 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB189 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | KVLPVPQ | KVLPVPQ | 7 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive;Antioxidant | In vitro | NA | ABTS radical scavenging Trolox equivalent antioxidant capacity (TEAC) method | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | 19mg/ml |
| FMDB190 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | VPYPQR | VPYPQR | 6 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Antioxidant;Anti-hypertensive | In vitro | NA | ABTS radical scavenging Trolox equivalent antioxidant capacity (TEAC) method | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB193 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | VPDPVRGLHP | VPDPVRGLHP | 10 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB741 | NA | NA | DELQDKIHP | DELQDKIHP | 9 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1093.64 | NA | |
| FMDB742 | NA | NA | DELQDKIHPF | DELQDKIHPF | 10 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1240.71 | NA | |
| FMDB743 | NA | NA | DELQDKIHPFAQTQ | DELQDKIHPFAQTQ | 14 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1668.86 | NA | |
| FMDB748 | NA | NA | IPPLTQTPVVVPPFLQPE | IPPLTQTPVVVPPFLQPE | 18 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1971.34 | NA | |
| FMDB749 | NA | NA | KVLPVPQK | KVLPVPQK | 8 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Antioxidant;Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 907.63 | NA | |
| FMDB750 | NA | NA | LHLPLPLLQSW | LHLPLPLLQSW | 11 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1315.92 | NA | |
| FMDB751 | NA | NA | LPLPLLQSW | LPLPLLQSW | 9 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1064.63 | NA | |
| FMDB752 | NA | NA | LPLPLLQSWM | LPLPLLQSWM | 10 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1196.86 | NA | |
| FMDB758 | NA | NA | NLHLPLPLLQSW | NLHLPLPLLQSW | 12 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1430.03 | NA | |
| FMDB759 | NA | NA | PPLTQTPVVVP | PPLTQTPVVVP | 11 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1146.12 | NA | |
| FMDB760 | NA | NA | PPVVVPPFLQPEIM | PPVVVPPFLQPEIM | 14 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1565.96 | NA | |
| FMDB761 | NA | NA | QDKIHPFAQTQ | QDKIHPFAQTQ | 11 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1311.66 | NA | |
| FMDB764 | NA | NA | SLPQNIPPLTQTPVVVPPFLQPE | SLPQNIPPLTQTPVVVPPFLQPE | 23 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 2510.36 | NA | |
| FMDB766 | NA | NA | SLVYPFPGPIPKSLPQ | SLVYPFPGPIPKSLPQ | 16 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Opioid;Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1739.02 | NA | |
| FMDB768 | NA | NA | TPVVVPPFLQPEIM | TPVVVPPFLQPEIM | 14 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1565.96 | NA | |
| FMDB1014 | 22450789 | NA | NA | QFYAV | QFYAV | 5 | Korean trad. Rice wine | NA | NA | NA | NA | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Nuruk as starter | NA | LC-MS/MS | NA | 468.7 Da | 0.34mg/ml |
| FMDB1015 | 22450789 | NA | NA | AGPVLL | AGPVLL | 6 | Korean trad. Rice wine | NA | NA | NA | NA | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Nuruk as starter | NA | LC-MS/MS | NA | 357.7 Da | 1.23mg/ml |
| FMDB1283 | NA | kajimoto02 | Hypotensive effects of tablets containing “lactotripeptides (VPP, IPP)” | IPP | IPP | 3 | Yogurt | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | L. helveticus and S. cerevisiae | Proteinase | NA | NA | NA | 5 micro mol /l |
| FMDB1284 | NA | kajimoto02 | Hypotensive effects of tablets containing “lactotripeptides (VPP, IPP)” | IPP | IPP | 3 | Yogurt | k-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | L. helveticus and S. cerevisiae | Proteinase | NA | NA | NA | 5 micro mol /l |
| FMDB1285 | NA | kajimoto02 | Hypotensive effects of tablets containing “lactotripeptides (VPP, IPP)” | VPP | VPP | 3 | Yogurt | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | L. helveticus and S. cerevisiae | Proteinase | NA | NA | NA | 9micromol/l |
| FMDB1286 | 20172208 | NA | NA | YQDPRLGPTGELDPATQPIVAVHNPVIV | YQDPRLGPTGELDPATQPIVAVHNPVIV | 28 | Koumiss ( fermented mare's Milk) | β-Casein | NA | NA | NA | Anti-hypertensive | In vitro | NA | NA | LAB and yeast | NA | NA | NA | NA | 14.53 ± 0.21 μM |
| FMDB1287 | 20172208 | NA | NA | PKDLREN | PKDLREN | 7 | Koumiss ( fermented mare's Milk) | Not known | NA | NA | NA | Anti-hypertensive | In vitro | NA | NA | LAB and yeast | NA | NA | NA | NA | 9.82 ± 0.37 μM |
| FMDB1288 | 20172208 | NA | NA | LLLAHLL | LLLAHLL | 7 | Koumiss ( fermented mare's Milk) | Not known | NA | NA | NA | Anti-hypertensive | In vitro | NA | NA | LAB and yeast | NA | NA | NA | NA | 5.19 ± 0.18 μM |
| FMDB1289 | 20172208 | NA | NA | NHRNRMMDHVH | NHRNRMMDHVH | 11 | Koumiss ( fermented mare's Milk) | Not known | NA | NA | NA | Anti-hypertensive | In vitro | NA | NA | LAB and yeast | NA | NA | NA | NA | 13.42 ± 0.17 μM |
| FMDB1574 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | KEMPFPKYPVE | KEMPFPKYPVE | 11 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 682.840 +2 | 1363.68 | NA |
| FMDB1575 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | WMHQPPQPLPPTVMFPPQSVL | WMHQPPQPLPPTVMFPPQSVL | 21 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1214.088+2 | 2426.18 | NA |
| FMDB1576 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | MHQPPQPLPPTVMFPPQSVL | MHQPPQPLPPTVMFPPQSVL | 20 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1121.057+2 | 2240.11 | NA |
| FMDB1577 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | HQPPQPLPPTVMFPPQSVL | HQPPQPLPPTVMFPPQSVL | 19 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1055.544+2 | 2109.09 | NA |
| FMDB1578 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | YQEPVLGPVRGPFPI | YQEPVLGPVRGPFPI | 15 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 834.880 +2 | 1667.76 | NA |
| FMDB1579 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | QEPVLGPVRGPFPILV | QEPVLGPVRGPFPILV | 16 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 859.491 +2 | 1716.98 | NA |
| FMDB1580 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | QEPVLGPVRGPFPI | QEPVLGPVRGPFPI | 14 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 753.416 +2 | 1504.83 | NA |
| FMDB1581 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | PVLGPVRGPFPI | PVLGPVRGPFPI | 12 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 624.847+ 2 | 1247.69 | NA |
| FMDB1582 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | LGPVRGPFPI | LGPVRGPFPI | 10 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 526.808 +2 | 1051.61 | NA |
| FMDB1583 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | TDAPSFSDIPNPIGSENSGK | TDAPSFSDIPNPIGSENSGK | 20 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1016.976+2 | 2031.95 | NA |
| FMDB1584 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | DIPNPIGSENSGKTTMPLW | DIPNPIGSENSGKTTMPLW | 19 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1028.993+2 | 2055.98 | NA |
| FMDB1585 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | IPNPIGSENSGKIT | IPNPIGSENSGKIT | 14 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 713.872 +2 | 1425.74 | NA |
| FMDB1586 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | NAGPFTPTVNR | NAGPFTPTVNR | 11 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 587.320 +2 | 1172.62 | NA |
| FMDB1587 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | YQGPIVLNPWDQVKR | YQGPIVLNPWDQVKR | 15 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 604.993+ 3 | 1811.96 | NA |
| FMDB1588 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | YQGPIVLNPWDQVK | YQGPIVLNPWDQVK | 14 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 828.895 +2 | 1655.78 | NA |
| FMDB1589 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | GPIVLNPWDQVKR | GPIVLNPWDQVKR | 13 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 761.428+ 2 | 1520.86 | NA |
| FMDB1590 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | VLNPWDQVKR | VLNPWDQVKR | 10 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 627.840 +2 | 1253.68 | NA |
| FMDB1735 | 26616950;12417344 | NA | NA | FALPQYLK | FALPQYLK | 8 | Casein (raw Milk) | αS2-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1736 | 26616950;12417344 | NA | NA | FALPQYLK | FALPQYLK | 8 | Casein (Heat treated Milk with open vials) | αS2-Casein | NA | 24 C and then at 4c | 25 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1737 | 26616950;12417344 | NA | NA | FALPQYLK | FALPQYLK | 8 | Casein (Heat treated Milk with closed vials) | αS2-Casein | NA | 25 C and then at 4c | 26 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1738 | 26616950;12417344 | NA | NA | FALPQYLK | FALPQYLK | 8 | Casein (Kefir) | αS2-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1739 | 26616950; 8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Casein (raw Milk) | αS2-Casein | NA | 24 C and then at 4c | 25 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1740 | 26616950; 8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Casein (Heat treated Milk with open vials) | αS2-Casein | NA | 25 C and then at 4c | 26 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1741 | 26616950; 8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Casein (Heat treated Milk with closed vials) | αS2-Casein | NA | 26 C and then at 4c | 27 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1742 | 26616950; 8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Casein (Kefir) | αS2-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1743 | 26616950;7790570 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Casein (raw Milk) | β-Casein | NA | 24 C and then at 4c | 25 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1744 | 26616950;7790570 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 25 C and then at 4c | 26 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1745 | 26616950;7790570 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Casein (Heat treated Milk with closed vials) | β-Casein | NA | 26 C and then at 4c | 27 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1746 | 26616950;7790570 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1747 | 26616950; Maruyama et al., 1985 | NA | Angiotensin I-Converting EnzymeInhibitor Derived from anEnzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of Rats | AVPYPQR | AVPYPQR | 7 | Casein (raw Milk) | b-Casokinin-7 | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1748 | 26616950; Maruyama et al., 1985 | NA | NA | AVPYPQR | AVPYPQR | 7 | Casein (Heat treated Milk with open vials) | b-Casokinin-7 | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1749 | 26616950; Maruyama et al., 1985 | NA | NA | AVPYPQR | AVPYPQR | 7 | Casein (Heat treated Milk with closed vials) | b-Casokinin-7 | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1750 | 26616950; Maruyama et al., 1985 | NA | NA | AVPYPQR | AVPYPQR | 7 | Casein (Kefir) | b-Casokinin-7 | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1767 | 26616950;1471476 | NA | NA | YPVEPFTE | YPVEPFTE | 8 | Casein (raw Milk) | Casohypotensin | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1768 | 26616950;1471476 | NA | NA | YPVEPFTE | YPVEPFTE | 8 | Casein (Heat treated Milk with open vials) | Casohypotensin | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1769 | 26616950;1471476 | NA | NA | YPVEPFTE | YPVEPFTE | 8 | Casein (Heat treated Milk with closed vials) | Casohypotensin | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1770 | 26616950;1471476 | NA | NA | YPVEPFTE | YPVEPFTE | 8 | Casein (Kefir) | Casohypotensin | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1771 | 26616950;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Casein (raw Milk) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1772 | 26616950;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1773 | 26616950;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Casein (Heat treated Milk with closed vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1774 | 26616950;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1784 | 26616950;17483270 | NA | NA | VLNENLLR | VLNENLLR | 8 | Casein (raw Milk) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1785 | 26616950; 17483270 | NA | NA | VLNENLLR | VLNENLLR | 8 | Casein (Heat treated Milk with open vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1786 | 26616950; 17483271 | NA | NA | VLNENLLR | VLNENLLR | 8 | Casein (Heat treated Milk with closed vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1787 | 26616950; 17483272 | NA | NA | VLNENLLR | VLNENLLR | 8 | Casein (Kefir) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1788 | 26616950; 17483273 | NA | NA | SQSKVLPVPQ | SQSKVLPVPQ | 10 | Casein (raw Milk) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1789 | 26616950; 17483274 | NA | NA | SQSKVLPVPQ | SQSKVLPVPQ | 10 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1790 | 26616950; 17483275 | NA | NA | SQSKVLPVPQ | SQSKVLPVPQ | 10 | Casein (Heat treated Milk with closed vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1791 | 26616950; 17483276 | NA | NA | SQSKVLPVPQ | SQSKVLPVPQ | 10 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1792 | 26616950; 17483277 | NA | NA | MPFPKYPVEP | MPFPKYPVEP | 10 | Casein (raw Milk) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1793 | 26616950; 17483278 | NA | NA | MPFPKYPVEP | MPFPKYPVEP | 10 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1794 | 26616950; 17483279 | NA | NA | MPFPKYPVEP | MPFPKYPVEP | 10 | Casein (Heat treated Milk with closed vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1795 | 26616950; 17483280 | NA | NA | MPFPKYPVEP | MPFPKYPVEP | 10 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1796 | 26616950; 17483281 | NA | NA | IGSENSEKTTMP | IGSENSEKTTMP | 12 | Casein (raw Milk) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1797 | 26616950; 17483282 | NA | NA | IGSENSEKTTMP | IGSENSEKTTMP | 12 | Casein (Heat treated Milk with open vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1798 | 26616950; 17483283 | NA | NA | IGSENSEKTTMP | IGSENSEKTTMP | 12 | Casein (Heat treated Milk with closed vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1804 | 26616950;10966406 | NA | NA | NIPPLTQTPV | NIPPLTQTPV | 10 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1805 | 26616950;10966406 | NA | NA | NIPPLTQTPV | NIPPLTQTPV | 10 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1806 | 26616950;10966406 | NA | NA | DKIHPF | DKIHPF | 6 | Casein (raw Milk) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1807 | 26616950;10966406 | NA | NA | DKIHPF | DKIHPF | 6 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1808 | 26616950;10966406 | NA | NA | DKIHPF | DKIHPF | 6 | Casein (Heat treated Milk with closed vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1809 | 26616950;10966406 | NA | NA | DKIHPF | DKIHPF | 6 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1810 | 26616950 | NA | NA | VAPFPEVF | VAPFPEVF | 8 | Casein (raw Milk) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1811 | 26616950 | NA | NA | VAPFPEVF | VAPFPEVF | 8 | Casein (Heat treated Milk with open vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1812 | 26616950 | NA | NA | VAPFPEVF | VAPFPEVF | 8 | Casein (Heat treated Milk with closed vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1813 | 26616950 | NA | NA | VAPFPEVF | VAPFPEVF | 8 | Casein (Kefir) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1814 | 26616950 | NA | NA | FVAPFPEV | FVAPFPEV | 8 | Casein (raw Milk) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1815 | 26616950 | NA | NA | FVAPFPEV | FVAPFPEV | 8 | Casein (Heat treated Milk with open vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1816 | 26616950 | NA | NA | FVAPFPEV | FVAPFPEV | 8 | Casein (Heat treated Milk with closed vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1817 | 26616950 | NA | NA | FVAPFPEV | FVAPFPEV | 8 | Casein (Kefir) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1819 | 15328207 | NA | Structural Analysis of a New Anti-Hypertensive Peptide (β-Lactosin B) Isolated from a Commercial Whey Product | ALPM “β-lactosin B” | ALPM | 5 | commercial Whey product, WE80BG | β-lactoglobulin | NA | NA | NA | Anti-hypertensive | In vivo | NA | NA | NA | NA | RPHPLC and N terminal sequencing by Edman degradation | NA | NA | 928uM |
| FMDB1979 | 12843654 | NA | NA | VLSLSQPKVLPVPQKAVPQ | VLSLSQPKVLPVPQKAVPQ | 19 | Skim Milk | β-Casein | NA | 38C | 20h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus acidophilus, Lactobacillus helveticus and Saccharomyces cerevisiae | NA | MALDITOF-MS | 2029.4893 | NA | NA |
| FMDB1994 | 19994857 | NA | NA | AW | AW | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 10 microM |
| FMDB1995 | 19994857 | NA | NA | GW | GW | 2 | Fermented soyabean seasoning | NA | NA | 26 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 30 microM |
| FMDB1996 | 19994857 | NA | NA | AY | AY | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 48 microM |
| FMDB1997 | 19994857 | NA | NA | SY | SY | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 67 microM |
| FMDB1998 | 19994857 | NA | NA | GY | GY | 2 | Fermented soyabean seasoning | NA | NA | NA | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 97 microM |
| FMDB1999 | 19994857 | NA | NA | AF | AF | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 190 microM |
| FMDB2000 | 19994857 | NA | NA | VP | VP | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 480 microM |
| FMDB2001 | 19994857 | NA | NA | AI | AI | 2 | Fermented soyabean seasoning | NA | NA | NA | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 690 microM |
| FMDB2002 | 19994857 | NA | NA | VG | VG | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 1100 microM |
| FMDB2003 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 7.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60208 or H9) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2004 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 7.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60208 or H9) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2005 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30046) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2006 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30046) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2007 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 34.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60205) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2008 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 32.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU10142) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2009 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 32.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU10142) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2010 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 15.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30005) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2011 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 15.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30005) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2012 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60207) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2013 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60207) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2014 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60210) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2015 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60210) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2016 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60211) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2017 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60211) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2018 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60204) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2019 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60204) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2020 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50010) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2021 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60201) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2022 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60201) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2023 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 24.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60220) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2024 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60066) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2025 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60066) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2026 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.2h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60212) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2027 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.2h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60212) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2028 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50151) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2029 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50151) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2030 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60117) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2031 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60117) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2032 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30003) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2033 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30003) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2034 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 23h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30023) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2035 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 42.4h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50061) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2036 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30134) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2037 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30134) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2038 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 14.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60206) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2039 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 14.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60206) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2040 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50011) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |