| FMDB5 | 8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | proteases | NA | NA | NA | 4uM |
| FMDB6 | 8201050 | NA | NA | GPFPIIV | GPFPIIV | 7 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | proteases | NA | NA | NA | 4uM |
| FMDB7 | 8201050 | NA | NA | GTQYTDAPSFSDIPNPIGSENSEKTTMPLW | GTQYTDAPSFSDIPNPIGSENSEKTTMPLW | 30 | Milk | αS1-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 346uM |
| FMDB8 | 8201050 | NA | NA | KYPVQPFTESQSLTL | KYPVQPFTESQSLTL | 15 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 93uM |
| FMDB9 | 8201050 | NA | NA | SVLSLSESKVLPVPE | SVLSLSESKVLPVPE | 15 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 39uM |
| FMDB10 | 8201050 | NA | NA | PPQSVLSLSESKVLPVPE | PPQSVLSLSESKVLPVPE | 18 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 25uM |
| FMDB11 | 8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 209uM |
| FMDB12 | 8201050 | NA | NA | YQQPVLGPVRGPFPIIV | YQQPVLGPVRGPFPIIV | 17 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 101uM |
| FMDB13 | 8201050 | NA | NA | LPQNIPPLTQTPVVVPPFLQPEVMGVSK | LPQNIPPLTQTPVVVPPFLQPEVMGVSK | 28 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 144uM |
| FMDB14 | 8201050 | NA | NA | LLYQQPVLGPVRGPFPIIV | LLYQQPVLGPVRGPFPIIV | 19 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 21uM |
| FMDB15 | 8201050 | NA | NA | DELQDKIHPFATQSLVYPFPGPIHNS | DELQDKIHPFATQSLVYPFPGPIHNS | 26 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 4uM |
| FMDB16 | 8201050 | NA | NA | AVPYPQR | AVPYPQR | 7 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 15uM |
| FMDB17 | 12369200 | NA | NA | IPP | IPP | 3 | calpis sour Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus and Saccharomyces cerevisiae | Proteinase | NA | NA | NA | 5 micro mol /l |
| FMDB18 | 12369200 | NA | NA | IPP | IPP | 3 | calpis sour Milk | k-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus and Saccharomyces cerevisiae | Proteinase | NA | NA | NA | 5 micro mol /l |
| FMDB19 | 12369200 | NA | NA | VPP | VPP | 3 | calpis sour Milk | bovine β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus and Saccharomyces cerevisiae | Proteinase | NA | NA | NA | 9micromol/l |
| FMDB20 | 7673515 | NA | NA | VPP | VPP | 3 | Skim Milk | β-Casein | 4.2 | 37C | 8-10h | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus LBK16H and Saccharomyces cerevisae | proteinase | NA | NA | NA | NA |
| FMDB21 | 7673515 | NA | NA | IPP | IPP | 3 | Skim Milk | β-Casein | 4.2 | 37C | 8-10h | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus LBK16H and Saccharomyces cerevisae | proteinase | NA | NA | NA | NA |
| FMDB22 | 7673515 | NA | NA | IPP | IPP | 3 | Skim Milk | k-Casein | 4.2 | 37C | 8-10h | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus LBK16H and Saccharomyces cerevisae | proteinase | NA | NA | NA | NA |
| FMDB31 | 25222748 | NA | NA | DVWY | DVWY | 4 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 582.5 | 0.69±0.04 mM |
| FMDB32 | 25222748 | NA | NA | FDART | FDART | 5 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 609.6 | 1.9±0.1 mM |
| FMDB33 | 25222748 | NA | NA | FQ | FQ | 2 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 294.2 | 7.4±0.6 mM |
| FMDB34 | 25222748 | NA | NA | VAE | VAE | 3 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 318 | 55.9±1.9 mM |
| FMDB35 | 25222748 | NA | NA | VVG | VVG | 3 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 274.2 | 39.6±5.7 mM |
| FMDB36 | 25222748 | NA | NA | WTFR | WTFR | 4 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 609.5 | 6.7±0.5 mM |
| FMDB39 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | DDQNPH | DDQNPH | 6 | Milk | α-LA | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 723.9 | 0.05ug/ml |
| FMDB40 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | LDDDLTDDI | LDDDLTDDI | 9 | Milk | α-LA | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1032.8 | 0.05ug/ml |
| FMDB41 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | YPSYGL | YPSYGL | 6 | Milk | k-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 698.6 | NA |
| FMDB42 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | HPHPHLSFMAIPP | HPHPHLSFMAIPP | 13 | Milk | k-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1479 | NA |
| FMDB43 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | YDTQAIVQ | YDTQAIVQ | 8 | Milk | α-LA | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1035.7 | NA |
| FMDB44 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | DDDLTDDIMCV | DDDLTDDIMCV | 11 | Milk | α-LA | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1386.8 | NA |
| FMDB45 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | YPSYG | YPSYG | 5 | Milk | k-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 585.9 | NA |
| FMDB46 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | AESIS | AESIS | 5 | Milk | AlphaSI-CN | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 505.9 | NA |
| FMDB47 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | SITRINK | SITRINK | 7 | Milk | β-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 830.1 | NA |
| FMDB48 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | HIQKEDVPS | HIQKEDVPS | 9 | Milk | AlphaSI-CN | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1051.4 | NA |
| FMDB49 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | TVQVTSTAV | TVQVTSTAV | 9 | Milk | k-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 904.1 | NA |
| FMDB50 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | NAVPITPTLN | NAVPITPTLN | 10 | Milk | αS2-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1038.4 | NA |
| FMDB51 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | SLPQNIPPL | SLPQNIPPL | 9 | Milk | β-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 977.1 | NA |
| FMDB52 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | QEPVLGPVRGPFPIIV | QEPVLGPVRGPFPIIV | 16 | Milk | β-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1716.9 | NA |
| FMDB53 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Milk | β-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1150.4 | NA |
| FMDB54 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | YIPIQYVLS | YIPIQYVLS | 9 | Milk | k-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1094.4 | NA |
| FMDB55 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | TVQVTSTAV | TVQVTSTAV | 9 | Milk | k-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 904.4 | NA |
| FMDB56 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | PEINTVQVTSTAV | PEINTVQVTSTAV | 13 | Milk | k-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 1356.7 | NA |
| FMDB57 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | GYLAVA | GYLAVA | 6 | Milk | Serotransferrin | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50571 | NA | LC-MS | NA | 591.8 | NA |
| FMDB58 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | DVENLHLPLPLL | DVENLHLPLPLL | 12 | Milk | β-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50572 | NA | LC-MS | NA | 1371.53 | NA |
| FMDB59 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | YPSYGL | YPSYGL | 6 | Milk | β-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50572 | NA | LC-MS | NA | 698.6 | NA |
| FMDB60 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | ENGEC | ENGEC | 5 | Milk | b-lactoglobulin | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50572 | NA | LC-MS | NA | 549.8 | NA |
| FMDB61 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | TVQVTSTAV | TVQVTSTAV | 9 | Milk | k-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50572 | NA | LC-MS | NA | 904.2 | NA |
| FMDB62 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Milk | β-Casein | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50572 | NA | LC-MS | NA | 1150.5 | NA |
| FMDB63 | NA | Ashar04 | Fermented Milk containing ACE-inhibitory peptides reduces blood pressure in middle aged hypertensive subjects | TDDIMCVK | TDDIMCVK | 8 | Milk | α-LA | NA | 30C | 12h | Anti-hypertensive;Cholestrol-lowering | NA | spontaneously Hypertensive Rats | NA | Lactococcus lactis strains NRRL B50572 | NA | LC-MS | NA | 922 4 | NA |
| FMDB111 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB112 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB113 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB114 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB178 | NA | pan05 | Antihypertensive peptides from skimmed Milk hydrolysate digested by cell-free extract of Lactobacillus helveticus JCM1004 | VPP | VPP | 3 | Skimmed Milk | β-Casein &k Casein | 6.5-7.0 | 37c | 20h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substarte | Lactobacillus helveticus JCM1004 | proteinase and peptidase | RPHPLC and protein sequencer | NA | NA | 9.13 ± 0.21 uM |
| FMDB179 | NA | pan05 | NA | IPP | IPP | 3 | Skimmed Milk | β-Casein &k Casein | 6.5-7.0 | 37c | 20h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substarte | Lactobacillus helveticus JCM1004 | proteinase and peptidase | RPHPLC and protein sequencer | NA | NA | 5.15 ± 0.17 UM |
| FMDB182 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | LPP | LPP | 3 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB187 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | SPVVPFTE | SPVVPFTE | 8 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB188 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | LHLPLPL | LHLPLPL | 7 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB189 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | KVLPVPQ | KVLPVPQ | 7 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive;Antioxidant | In vitro | NA | ABTS radical scavenging Trolox equivalent antioxidant capacity (TEAC) method | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | 19mg/ml |
| FMDB190 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | VPYPQR | VPYPQR | 6 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Antioxidant;Anti-hypertensive | In vitro | NA | ABTS radical scavenging Trolox equivalent antioxidant capacity (TEAC) method | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB193 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | VPDPVRGLHP | VPDPVRGLHP | 10 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB741 | NA | | NA | DELQDKIHP | DELQDKIHP | 9 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1093.64 | NA |
| FMDB742 | NA | | NA | DELQDKIHPF | DELQDKIHPF | 10 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1240.71 | NA |
| FMDB743 | NA | | NA | DELQDKIHPFAQTQ | DELQDKIHPFAQTQ | 14 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1668.86 | NA |
| FMDB748 | NA | | NA | IPPLTQTPVVVPPFLQPE | IPPLTQTPVVVPPFLQPE | 18 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1971.34 | NA |
| FMDB749 | NA | | NA | KVLPVPQK | KVLPVPQK | 8 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Antioxidant;Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 907.63 | NA |
| FMDB750 | NA | | NA | LHLPLPLLQSW | LHLPLPLLQSW | 11 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1315.92 | NA |
| FMDB751 | NA | | NA | LPLPLLQSW | LPLPLLQSW | 9 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1064.63 | NA |
| FMDB752 | NA | | NA | LPLPLLQSWM | LPLPLLQSWM | 10 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1196.86 | NA |
| FMDB758 | NA | | NA | NLHLPLPLLQSW | NLHLPLPLLQSW | 12 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1430.03 | NA |
| FMDB759 | NA | | NA | PPLTQTPVVVP | PPLTQTPVVVP | 11 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1146.12 | NA |
| FMDB760 | NA | | NA | PPVVVPPFLQPEIM | PPVVVPPFLQPEIM | 14 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1565.96 | NA |
| FMDB761 | NA | | NA | QDKIHPFAQTQ | QDKIHPFAQTQ | 11 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1311.66 | NA |
| FMDB764 | NA | | NA | SLPQNIPPLTQTPVVVPPFLQPE | SLPQNIPPLTQTPVVVPPFLQPE | 23 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 2510.36 | NA |
| FMDB766 | NA | | NA | SLVYPFPGPIPKSLPQ | SLVYPFPGPIPKSLPQ | 16 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Opioid;Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1739.02 | NA |
| FMDB768 | NA | | NA | TPVVVPPFLQPEIM | TPVVVPPFLQPEIM | 14 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1565.96 | NA |
| FMDB1014 | 22450789 | NA | NA | QFYAV | QFYAV | 5 | Korean trad. Rice wine | NA | NA | NA | NA | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Nuruk as starter | NA | LC-MS/MS | NA | 468.7 Da | 0.34mg/ml |
| FMDB1015 | 22450789 | NA | NA | AGPVLL | AGPVLL | 6 | Korean trad. Rice wine | NA | NA | NA | NA | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Nuruk as starter | NA | LC-MS/MS | NA | 357.7 Da | 1.23mg/ml |
| FMDB1283 | NA | kajimoto02 | Hypotensive effects of tablets containing “lactotripeptides (VPP, IPP)” | IPP | IPP | 3 | Yogurt | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | L. helveticus and S. cerevisiae | Proteinase | NA | NA | NA | 5 micro mol /l |
| FMDB1284 | NA | kajimoto02 | Hypotensive effects of tablets containing “lactotripeptides (VPP, IPP)” | IPP | IPP | 3 | Yogurt | k-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | L. helveticus and S. cerevisiae | Proteinase | NA | NA | NA | 5 micro mol /l |
| FMDB1285 | NA | kajimoto02 | Hypotensive effects of tablets containing “lactotripeptides (VPP, IPP)” | VPP | VPP | 3 | Yogurt | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | L. helveticus and S. cerevisiae | Proteinase | NA | NA | NA | 9micromol/l |
| FMDB1286 | 20172208 | NA | NA | YQDPRLGPTGELDPATQPIVAVHNPVIV | YQDPRLGPTGELDPATQPIVAVHNPVIV | 28 | Koumiss ( fermented mare's Milk) | β-Casein | NA | NA | NA | Anti-hypertensive | In vitro | NA | NA | LAB and yeast | NA | NA | NA | NA | 14.53 ± 0.21 μM |
| FMDB1287 | 20172208 | NA | NA | PKDLREN | PKDLREN | 7 | Koumiss ( fermented mare's Milk) | Not known | NA | NA | NA | Anti-hypertensive | In vitro | NA | NA | LAB and yeast | NA | NA | NA | NA | 9.82 ± 0.37 μM |
| FMDB1288 | 20172208 | NA | NA | LLLAHLL | LLLAHLL | 7 | Koumiss ( fermented mare's Milk) | Not known | NA | NA | NA | Anti-hypertensive | In vitro | NA | NA | LAB and yeast | NA | NA | NA | NA | 5.19 ± 0.18 μM |
| FMDB1289 | 20172208 | NA | NA | NHRNRMMDHVH | NHRNRMMDHVH | 11 | Koumiss ( fermented mare's Milk) | Not known | NA | NA | NA | Anti-hypertensive | In vitro | NA | NA | LAB and yeast | NA | NA | NA | NA | 13.42 ± 0.17 μM |
| FMDB1574 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | KEMPFPKYPVE | KEMPFPKYPVE | 11 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 682.840 +2 | 1363.68 | NA |
| FMDB1575 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | WMHQPPQPLPPTVMFPPQSVL | WMHQPPQPLPPTVMFPPQSVL | 21 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1214.088+2 | 2426.18 | NA |
| FMDB1576 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | MHQPPQPLPPTVMFPPQSVL | MHQPPQPLPPTVMFPPQSVL | 20 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1121.057+2 | 2240.11 | NA |
| FMDB1577 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | HQPPQPLPPTVMFPPQSVL | HQPPQPLPPTVMFPPQSVL | 19 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1055.544+2 | 2109.09 | NA |
| FMDB1578 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | YQEPVLGPVRGPFPI | YQEPVLGPVRGPFPI | 15 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 834.880 +2 | 1667.76 | NA |
| FMDB1579 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | QEPVLGPVRGPFPILV | QEPVLGPVRGPFPILV | 16 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 859.491 +2 | 1716.98 | NA |
| FMDB1580 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | QEPVLGPVRGPFPI | QEPVLGPVRGPFPI | 14 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 753.416 +2 | 1504.83 | NA |
| FMDB1581 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | PVLGPVRGPFPI | PVLGPVRGPFPI | 12 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 624.847+ 2 | 1247.69 | NA |
| FMDB1582 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | LGPVRGPFPI | LGPVRGPFPI | 10 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 526.808 +2 | 1051.61 | NA |
| FMDB1583 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | TDAPSFSDIPNPIGSENSGK | TDAPSFSDIPNPIGSENSGK | 20 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1016.976+2 | 2031.95 | NA |
| FMDB1584 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | DIPNPIGSENSGKTTMPLW | DIPNPIGSENSGKTTMPLW | 19 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1028.993+2 | 2055.98 | NA |
| FMDB1585 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | IPNPIGSENSGKIT | IPNPIGSENSGKIT | 14 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 713.872 +2 | 1425.74 | NA |
| FMDB1586 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | NAGPFTPTVNR | NAGPFTPTVNR | 11 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 587.320 +2 | 1172.62 | NA |
| FMDB1587 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | YQGPIVLNPWDQVKR | YQGPIVLNPWDQVKR | 15 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 604.993+ 3 | 1811.96 | NA |
| FMDB1588 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | YQGPIVLNPWDQVK | YQGPIVLNPWDQVK | 14 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 828.895 +2 | 1655.78 | NA |
| FMDB1589 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | GPIVLNPWDQVKR | GPIVLNPWDQVKR | 13 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 761.428+ 2 | 1520.86 | NA |
| FMDB1590 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | VLNPWDQVKR | VLNPWDQVKR | 10 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 627.840 +2 | 1253.68 | NA |
| FMDB1735 | 26616950;12417344 | NA | NA | FALPQYLK | FALPQYLK | 8 | Casein (raw Milk) | αS2-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1736 | 26616950;12417344 | NA | NA | FALPQYLK | FALPQYLK | 8 | Casein (Heat treated Milk with open vials) | αS2-Casein | NA | 24 C and then at 4c | 25 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1737 | 26616950;12417344 | NA | NA | FALPQYLK | FALPQYLK | 8 | Casein (Heat treated Milk with closed vials) | αS2-Casein | NA | 25 C and then at 4c | 26 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1738 | 26616950;12417344 | NA | NA | FALPQYLK | FALPQYLK | 8 | Casein (Kefir) | αS2-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1739 | 26616950; 8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Casein (raw Milk) | αS2-Casein | NA | 24 C and then at 4c | 25 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1740 | 26616950; 8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Casein (Heat treated Milk with open vials) | αS2-Casein | NA | 25 C and then at 4c | 26 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1741 | 26616950; 8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Casein (Heat treated Milk with closed vials) | αS2-Casein | NA | 26 C and then at 4c | 27 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1742 | 26616950; 8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Casein (Kefir) | αS2-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1743 | 26616950;7790570 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Casein (raw Milk) | β-Casein | NA | 24 C and then at 4c | 25 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1744 | 26616950;7790570 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 25 C and then at 4c | 26 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1745 | 26616950;7790570 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Casein (Heat treated Milk with closed vials) | β-Casein | NA | 26 C and then at 4c | 27 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1746 | 26616950;7790570 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1747 | 26616950; Maruyama et al., 1985 | NA | Angiotensin I-Converting EnzymeInhibitor Derived from anEnzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of Rats | AVPYPQR | AVPYPQR | 7 | Casein (raw Milk) | b-Casokinin-7 | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1748 | 26616950; Maruyama et al., 1985 | NA | NA | AVPYPQR | AVPYPQR | 7 | Casein (Heat treated Milk with open vials) | b-Casokinin-7 | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1749 | 26616950; Maruyama et al., 1985 | NA | NA | AVPYPQR | AVPYPQR | 7 | Casein (Heat treated Milk with closed vials) | b-Casokinin-7 | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1750 | 26616950; Maruyama et al., 1985 | NA | NA | AVPYPQR | AVPYPQR | 7 | Casein (Kefir) | b-Casokinin-7 | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1767 | 26616950;1471476 | NA | NA | YPVEPFTE | YPVEPFTE | 8 | Casein (raw Milk) | Casohypotensin | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1768 | 26616950;1471476 | NA | NA | YPVEPFTE | YPVEPFTE | 8 | Casein (Heat treated Milk with open vials) | Casohypotensin | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1769 | 26616950;1471476 | NA | NA | YPVEPFTE | YPVEPFTE | 8 | Casein (Heat treated Milk with closed vials) | Casohypotensin | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1770 | 26616950;1471476 | NA | NA | YPVEPFTE | YPVEPFTE | 8 | Casein (Kefir) | Casohypotensin | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1771 | 26616950;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Casein (raw Milk) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1772 | 26616950;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1773 | 26616950;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Casein (Heat treated Milk with closed vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1774 | 26616950;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1784 | 26616950;17483270 | NA | NA | VLNENLLR | VLNENLLR | 8 | Casein (raw Milk) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1785 | 26616950; 17483270 | NA | NA | VLNENLLR | VLNENLLR | 8 | Casein (Heat treated Milk with open vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1786 | 26616950; 17483271 | NA | NA | VLNENLLR | VLNENLLR | 8 | Casein (Heat treated Milk with closed vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1787 | 26616950; 17483272 | NA | NA | VLNENLLR | VLNENLLR | 8 | Casein (Kefir) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1788 | 26616950; 17483273 | NA | NA | SQSKVLPVPQ | SQSKVLPVPQ | 10 | Casein (raw Milk) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1789 | 26616950; 17483274 | NA | NA | SQSKVLPVPQ | SQSKVLPVPQ | 10 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1790 | 26616950; 17483275 | NA | NA | SQSKVLPVPQ | SQSKVLPVPQ | 10 | Casein (Heat treated Milk with closed vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1791 | 26616950; 17483276 | NA | NA | SQSKVLPVPQ | SQSKVLPVPQ | 10 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1792 | 26616950; 17483277 | NA | NA | MPFPKYPVEP | MPFPKYPVEP | 10 | Casein (raw Milk) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1793 | 26616950; 17483278 | NA | NA | MPFPKYPVEP | MPFPKYPVEP | 10 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1794 | 26616950; 17483279 | NA | NA | MPFPKYPVEP | MPFPKYPVEP | 10 | Casein (Heat treated Milk with closed vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1795 | 26616950; 17483280 | NA | NA | MPFPKYPVEP | MPFPKYPVEP | 10 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1796 | 26616950; 17483281 | NA | NA | IGSENSEKTTMP | IGSENSEKTTMP | 12 | Casein (raw Milk) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1797 | 26616950; 17483282 | NA | NA | IGSENSEKTTMP | IGSENSEKTTMP | 12 | Casein (Heat treated Milk with open vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1798 | 26616950; 17483283 | NA | NA | IGSENSEKTTMP | IGSENSEKTTMP | 12 | Casein (Heat treated Milk with closed vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1804 | 26616950;10966406 | NA | NA | NIPPLTQTPV | NIPPLTQTPV | 10 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1805 | 26616950;10966406 | NA | NA | NIPPLTQTPV | NIPPLTQTPV | 10 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1806 | 26616950;10966406 | NA | NA | DKIHPF | DKIHPF | 6 | Casein (raw Milk) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1807 | 26616950;10966406 | NA | NA | DKIHPF | DKIHPF | 6 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1808 | 26616950;10966406 | NA | NA | DKIHPF | DKIHPF | 6 | Casein (Heat treated Milk with closed vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1809 | 26616950;10966406 | NA | NA | DKIHPF | DKIHPF | 6 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1810 | 26616950 | NA | NA | VAPFPEVF | VAPFPEVF | 8 | Casein (raw Milk) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1811 | 26616950 | NA | NA | VAPFPEVF | VAPFPEVF | 8 | Casein (Heat treated Milk with open vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1812 | 26616950 | NA | NA | VAPFPEVF | VAPFPEVF | 8 | Casein (Heat treated Milk with closed vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1813 | 26616950 | NA | NA | VAPFPEVF | VAPFPEVF | 8 | Casein (Kefir) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1814 | 26616950 | NA | NA | FVAPFPEV | FVAPFPEV | 8 | Casein (raw Milk) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1815 | 26616950 | NA | NA | FVAPFPEV | FVAPFPEV | 8 | Casein (Heat treated Milk with open vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1816 | 26616950 | NA | NA | FVAPFPEV | FVAPFPEV | 8 | Casein (Heat treated Milk with closed vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1817 | 26616950 | NA | NA | FVAPFPEV | FVAPFPEV | 8 | Casein (Kefir) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1819 | 15328207 | NA | Structural Analysis of a New Anti-Hypertensive Peptide (β-Lactosin B) Isolated from a Commercial Whey Product | ALPM “β-lactosin B” | ALPM | 5 | commercial Whey product, WE80BG | β-lactoglobulin | NA | NA | NA | Anti-hypertensive | In vivo | NA | NA | NA | NA | RPHPLC and N terminal sequencing by Edman degradation | NA | NA | 928uM |
| FMDB1979 | 12843654 | NA | NA | VLSLSQPKVLPVPQKAVPQ | VLSLSQPKVLPVPQKAVPQ | 19 | Skim Milk | β-Casein | NA | 38C | 20h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus acidophilus, Lactobacillus helveticus and Saccharomyces cerevisiae | NA | MALDITOF-MS | 2029.4893 | NA | NA |
| FMDB1994 | 19994857 | NA | NA | AW | AW | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 10 microM |
| FMDB1995 | 19994857 | NA | NA | GW | GW | 2 | Fermented soyabean seasoning | NA | NA | 26 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 30 microM |
| FMDB1996 | 19994857 | NA | NA | AY | AY | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 48 microM |
| FMDB1997 | 19994857 | NA | NA | SY | SY | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 67 microM |
| FMDB1998 | 19994857 | NA | NA | GY | GY | 2 | Fermented soyabean seasoning | NA | NA | NA | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 97 microM |
| FMDB1999 | 19994857 | NA | NA | AF | AF | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 190 microM |
| FMDB2000 | 19994857 | NA | NA | VP | VP | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 480 microM |
| FMDB2001 | 19994857 | NA | NA | AI | AI | 2 | Fermented soyabean seasoning | NA | NA | NA | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 690 microM |
| FMDB2002 | 19994857 | NA | NA | VG | VG | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 1100 microM |
| FMDB2003 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 7.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60208 or H9) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2004 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 7.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60208 or H9) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2005 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30046) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2006 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30046) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2007 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 34.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60205) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2008 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 32.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU10142) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2009 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 32.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU10142) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2010 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 15.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30005) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2011 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 15.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30005) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2012 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60207) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2013 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60207) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2014 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60210) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2015 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60210) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2016 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60211) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2017 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60211) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2018 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60204) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2019 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60204) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2020 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50010) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2021 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60201) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2022 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60201) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2023 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 24.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60220) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2024 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60066) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2025 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60066) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2026 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.2h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60212) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2027 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.2h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60212) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2028 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50151) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2029 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50151) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2030 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60117) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2031 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60117) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2032 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30003) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2033 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30003) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2034 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 23h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30023) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2035 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 42.4h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50061) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2036 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30134) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2037 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30134) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2038 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 14.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60206) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2039 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 14.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60206) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2040 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50011) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |