ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
---|---|---|---|---|---|---|---|---|---|---|---|---|
2933 | FHFHFRFR | F10 | 8 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2934 | rHHLrHLrrHLrHLLrHLrHHL | B2 | 22 | Mix | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2935 | rHNHrFNFrFFFNFrFNTrTN | B3 | 21 | Mix | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2936 | rLLrLLLrLWrrLLrLLr | B4 | 18 | Mix | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2937 | rHrHrrHrHrrHrHr | E4 | 15 | Mix | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2938 | rFTFHFrFEFTFHFE | E5 | 15 | Mix | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2939 | rrrrrrrrr | H3 | 9 | D | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2940 | LAELLAELLAELGGGGrrrrrrrrr | H4 | 25 | Mix | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2941 | HHHHHHrrrrrrrrr | H5 | 15 | Mix | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2942 | KLLKLLLKLWKKLLKLLKGGGRRRRRRR | A6 | 28 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2943 | HRLRHALAHLLHKLKHLLHALAHRLRH | A7 | 27 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2944 | HALAHKLKHLLHRLRHLLHRHLRHALAH | A8 | 28 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2945 | LAELLAELLAELGGGGRRRRRRRRR | A11 | 25 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2946 | LAQLLAQLLAQLGGGGRRRRRRRRR | A12 | 25 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2947 | ACSSSPSKHCGGGGRRRRRRRRR | B1 | 23 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2948 | KLALKLALKALKAALKLA | C2 | 18 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2949 | RLALRLALRALRAALRLA | C3 | 18 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2950 | KLLKLLLKLWKKLLKLLK | C5 | 18 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2951 | RLLRLLLRLWRRLLRLLR | C6 | 18 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
2952 | ACSSSPSKHCG | F4 | 11 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (siRNA) | 0 |
1023 | GRKKRRQRRPPQC | Arg deletion mutant of Tat (48-60) | 13 | L | Linear | Protein derived | Cationic | Free | Conjugation with fluorescein | NA | Fluorophore (fluorescein) | 0 |
1024 | GRKKRRQRPPQC | Arg deletion mutant of Tat (48-60) | 12 | L | Linear | Protein derived | Cationic | Free | Conjugation with fluorescein | NA | Fluorophore (fluorescein) | 0 |
1025 | GRKKRRQPPQC | Arg deletion mutant of Tat (48-60) | 11 | L | Linear | Protein derived | Cationic | Free | Conjugation with fluorescein | NA | Fluorophore (fluorescein) | 0 |
1026 | GRKKRRQRRRC | Pro deletion mutant of Tat (48-60) | 11 | L | Linear | Protein derived | Cationic | Free | Conjugation with fluorescein | NA | Fluorophore (fluorescein) | 0 |
1027 | GRKKRRQRARPPQC | Ala substitution mutant of Tat (48-60) | 14 | L | Linear | Protein derived | Cationic | Free | Conjugation with fluorescein | NA | Fluorophore (fluorescein) | 0 |
1028 | GRKKRRQARAPPQC | Ala substitution mutant of Tat (48-60) | 14 | L | Linear | Protein derived | Cationic | Free | Conjugation with fluorescein | NA | Fluorophore (fluorescein) | 0 |
1029 | TRQARRNRRRRWRERQR | Rev (34-50) | 17 | L | Linear | Protein derived | Cationic | Free | Conjugation with fluorescein by C-terminal Cys amide | NA | Fluorophore (fluorescein) | 11084031 |
1030 | RRRR | R4 | 4 | L | Linear | Synthetic | Cationic | Free | Conjugation with fluorescein by C-terminal Cys amide | NA | Fluorophore (fluorescein) | 11084031 |
1036 | RRRRRRRRRRR | R10 | 11 | L | Linear | Synthetic | Cationic | Free | Conjugation with fluorescein by C-terminal Gly Cys amide | NA | Fluorophore (fluorescein) | 11084031 |
1037 | RRRRRRRRRRRR | R12 | 12 | L | Linear | Synthetic | Cationic | Free | Conjugation with fluorescein by C-terminal Gly Cys amide | NA | Fluorophore (fluorescein) | 11084031 |
1038 | RRRRRRRRRRRRRRRR | R16 | 16 | L | Linear | Synthetic | Cationic | Free | Conjugation with fluorescein by C-terminal Gly Cys amide | NA | Fluorophore (fluorescein) | 11084031 |
1062 | KLALKLALKAWKAALKLA | KLA1 | 18 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | NA | 10323198 |
1063 | KLALKAALKAWKAAAKLA | KLA2 | 18 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | NA | 10323198 |
1064 | KLALKAAAKAWKAAAKAA | KLA3 | 18 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | NA | 10323198 |
1065 | KITLKLAIKAWKLALKAA | KLA11 | 18 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | NA | 10323198 |
1066 | KIAAKSIAKIWKSILKIA | KLA5 | 18 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | NA | 10323198 |
1067 | KALAKALAKLWKALAKAA | KLA12 | 18 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | NA | 10323198 |
1068 | KLALKLALKWAKLALKAA | KLA13 | 18 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | NA | 10323198 |
1069 | KLLAKAAKKWLLLALKAA | KLA14 | 18 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | NA | 10323198 |
1070 | KLLAKAALKWLLKALKAA | KLA9 | 18 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | NA | 10323198 |
1071 | KALKKLLAKWLAAAKALL | KLA10 | 18 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | NA | 10323198 |
1072 | KLAAALLKKWKKLAAALL | KLA15 | 18 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | NA | 10323198 |
1073 | KALAALLKKWAKLLAALK | KLA8 | 18 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | Fluorophore (fluorescein) | 10323198 |
1243 | VNADIKATTVFGGKYVSLTTP | Inv1 | 21 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |
1244 | GKYVSLTTPKNPTKRRITPKDV | Inv2 | 22 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |
1245 | TKRRITPKDVIDVRSVTTEINT | Inv3 | 22 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |
1246 | RSVTTEINTLFQTLTSIAEKVDP | Inv4 | 23 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |
1247 | AEKVDPVKLNLTLSAAAEALTGLGDK | Inv5 | 26 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |
1248 | GLGDKFGESIVNANTVLDDLNSRMPQSRHDIQQL | Inv6 | 34 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |
1249 | GDVYADAAPDLFDFLDSSVTTARTINA | Inv7 | 27 | L | Linear | Protein derived | Unknown | Free (peptide coated FITC labelled microspheres) | Free | NA | Nanoparticle [(FITC)-labeled latex microspheres] | 16620748 |