| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1765 | RVIRWFQNKRCKDKK | PN158 (SEQ ID NO: 67) | 15 | L | Linear | Synthetic | Unknown | Free | Amidation | NA | Nucleic acid (siRNA) | 0 |
| 1766 | LGLLLRHLRHHSNLLANI | PN86 (SEQ ID NO: 68) | 18 | L | Linear | Synthetic | Unknown | Acetylation | Amidation | NA | Nucleic acid (siRNA) | 0 |
| 1767 | KLWSAWPSLWSSLWKP | PN228 (SEQ ID NO: 70) | 16 | L | Linear | Synthetic | Unknown | Free | Amidation | NA | Nucleic acid (siRNA) | 0 |
| 1768 | GLGSLLKKAGKKLKQPKSKRKV | PN283 (SEQ ID NO: 73) | 22 | L | Linear | Synthetic | Unknown | Free | Amidation | NA | Nucleic acid (siRNA) | 0 |
| 1770 | YRFK | PN267 (SEQ ID NO: 77) | 4 | L | Linear | Synthetic | Unknown | Maleimide addition | Amidation | NA | Nucleic acid (siRNA) | 0 |
| 1771 | YRFKYRFKYRLFK | PN282 (SEQ ID NO: 78) | 13 | L | Linear | Synthetic | Unknown | Maleimide addition | Amidation | NA | Nucleic acid (siRNA) | 0 |
| 1772 | WRFKKSKRKV | PN290 (SEQ ID NO: 79) | 10 | L | Linear | Synthetic | Unknown | Maleimide addition | Amidation | NA | Nucleic acid (siRNA) | 0 |
| 1773 | WRFKAAVALLPAVLLALLAP | PN291 (SEQ ID NO: 80) | 20 | L | Linear | Synthetic | Unknown | Maleimide addition | Amidation | NA | Nucleic acid (siRNA) | 0 |
| 1774 | WRFKWRFK | PN287 (SEQ ID NO: 87) | 8 | L | Linear | Synthetic | Unknown | Maleimide addition | Amidation | NA | Nucleic acid (siRNA) | 0 |
| 1775 | WRFKWRFKWRFK | PN288 (SEQ ID NO: 88) | 12 | L | Linear | Synthetic | Unknown | Maleimide addition | Amidation | NA | Nucleic acid (siRNA) | 0 |
| 1776 | KGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQ | PN509 (SEQ ID NO: 90) | 36 | L | Linear | Synthetic | Unknown | PEGylation | Amidation | NA | Nucleic acid (siRNA) | 0 |
| 1777 | RGSRRAVTRAQRRDGRRRRRSRRESYSVYVYRVLRQ | PN404 (SEQ ID NO: 91) | 36 | L | Linear | Synthetic | Unknown | Free | Amidation | NA | Nucleic acid (siRNA) | 0 |
| 1778 | RVIRWFQNKRSKDKK | PN316 (SEQ ID NO: 92) | 15 | L | Linear | Synthetic | Unknown | Maleimide addition | Amidation | NA | Nucleic acid (siRNA) | 0 |
| 1779 | GWTLNSAGYLLGKINLKALAALAKKIL | PN161 (SEQ ID NO: 93) | 27 | L | Linear | Synthetic | Unknown | Free | Amidation | NA | Nucleic acid (siRNA) | 0 |
| 1780 | AAVALLPAVLLALLAPRKKRRQRRRPPQ | PN27 (SEQ ID NO: 94) | 28 | L | Linear | Synthetic | Unknown | Free | Amidation | NA | Nucleic acid (siRNA) | 0 |
| 1781 | CWKKK | AlkCWK3 (SEQ ID NO:4) | 5 | L | Linear | Synthetic | Cationic | Acetylation | Free | NA | Nucleic acid | 0 |
| 1782 | CWKKKKKKKK | AlkCWK8 (SEQ ID NO:5) | 10 | L | Linear | Synthetic | Cationic | Acetylation | Free | NA | Nucleic acid | 0 |
| 1783 | CWKKKKKKKKKKKKK | AlkCWK13 (SEQ ID NO:6) | 15 | L | Linear | Synthetic | Cationic | Acetylation | Free | NA | Nucleic acid | 0 |
| 1784 | CWKKKKKKKKKKKKKKKKKK | AlkCWK18 (SEQ ID NO:3) | 20 | L | Linear | Synthetic | Cationic | Acetylation | Free | NA | Nucleic acid | 0 |
| 1785 | KKKKKKKKKKKKKKKKKKK | Polylysine19 (SEQ ID NO:2) | 19 | L | Linear | Synthetic | Unknown | NA | Free | NA | Nucleic acid | 0 |
| 1787 | APWHLSSQYSRT | Cardiac targeting peptide | 12 | L | Linear | Synthetic | Unknown | Conjugation with 5(6)-Carboxyfluorescein | Free | NA | Fluorophore (6-carboxyfluorescene) | 20808875 |
| 1788 | AAVALLPAVLLALLAKKNNLKDCGLF | MPS-Galphai2 | 26 | L | Linear | Chimeric | Unknown | NA | Unknown | NA | NA | 11923291 |
| 1789 | AAVALLPAVLLALLAKKNNLKECGLY | MPS-Galphai3 | 26 | L | Linear | Chimeric | Unknown | NA | Unknown | NA | NA | 11923291 |
| 1790 | AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE | Anti-BetaGamma | 43 | L | Linear | Chimeric | Unknown | NA | Unknown | NA | NA | 11923291 |
| 1791 | AAVALLPAVLLALLAK | MPS | 16 | L | Linear | Protein derived | Unknown | NA | Unknown | NA | NA | 11923291 |
| 1792 | AHALCLTERQIKIWFQNRRMKWKKEN | pAntpHD | 26 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 8105471 |
| 1793 | AHALCPPERQIKIWFQNRRMKWKKEN | pAntpHD 40P2 | 26 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 8105471 |
| 1794 | AYALCLTERQIKIWFANRRMKWKKEN | pAntpHD 50A | 26 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 8105471 |
| 1795 | GGVCPKILKKCRRDSDCPGACICRGNGYCGSGSD | MCoTI-II(MCo) | 34 | L | Cyclic | Protein derived | Unknown | Conjugation with Alexa-488 | Cyclization | NA | Fluorophore (Alexa-488) | 21873420 |
| 1796 | GGVCPKILAACRRDSDCPGACICRGNGYCGSGSD | MCoKKAA double mutant | 34 | L | Cyclic | Protein derived | Unknown | Conjugation with Alexa-488 | Cyclization | NA | Fluorophore (Alexa-488) | 21873420 |
| 1797 | GGVCPAILKKCRRDSDCPGACICRGNGYCGSGSD | MCoK6A mutant | 34 | L | Cyclic | Protein derived | Unknown | Conjugation with Alexa-488 | Cyclization | NA | Fluorophore (Alexa-488) | 21873420 |
| 1798 | GGVCPKILAKCRRDSDCPGACICRGNGYCGSGSD | MCoK9A mutant | 34 | L | Cyclic | Protein derived | Unknown | Conjugation with Alexa-488 | Cyclization | NA | Fluorophore (Alexa-488) | 21873420 |
| 1799 | GGVCPKILKACRRDSDCPGACICRGNGYCGSGSD | MCoK10A mutant | 34 | L | Cyclic | Protein derived | Unknown | Conjugation with Alexa-488 | Cyclization | NA | Fluorophore (Alexa-488) | 21873420 |
| 1800 | GLPVCGETCVGGTCNTPGCKCSWPVCTRN | kT20K mutant | 29 | L | Cyclic | Protein derived | Unknown | Conjugation with Alexa-488 | Cyclization | NA | Fluorophore (Alexa-488) | 21873420 |
| 1801 | GLPVCGETCVGGTCNTPGCTCSWPKCTRN | kV25K mutant | 29 | L | Cyclic | Protein derived | Unknown | Conjugation with Alexa-488 | Cyclization | NA | Fluorophore (Alexa-488) | 21873420 |
| 1802 | GRCTKSIPPICFPD | SFTI-1 | 14 | L | Cyclic | Protein derived | Unknown | Conjugation with Alexa-488 | Cyclization | NA | Fluorophore (Alexa-488) | 21873420 |
| 1803 | RQIKIWFQNRRMKWKK | Penetratin {pAntp-(43-58)} | 16 | L | Linear | Protein derived | Amphipathic | Conjugation with rhodamine B | Free | NA | Fluorophore (rhodamine) | 15937518 |
| 1804 | RQIKIWFQNRRMKWKKTYADFIASGRTGRRNAI | pAntp–PKI | 33 | L | Linear | Protein derived | Unknown | Conjugation with rhodamine B | Free | NA | Fluorophore (rhodamine) | 15937518 |
| 1805 | GRKKRRQRRRPPQ | Tat | 13 | L | Linear | Protein derived | Cationic | Conjugation with rhodamine B | Free | NA | Fluorophore (rhodamine) | 15937518 |
| 1806 | GRKKRRQRRRPPQTYADFIASGRTGRRNAI | Tat-PKI | 30 | L | Linear | Protein derived | Unknown | Conjugation with rhodamine B | Free | NA | Fluorophore (rhodamine) | 15937518 |
| 1807 | AGYLLGKINLKALAALAKKIL | Transportan | 21 | L | Linear | Chimeric | Amphipathic | Conjugation with rhodamine B | Free | NA | Fluorophore (rhodamine) | 15937518 |
| 1808 | AGYLLGKINLKALAALAKKILTYADFIASGRTGRRNAI | Transportan-PKI | 38 | L | Linear | Chimeric | Unknown | Conjugation with rhodamine B | Free | NA | Fluorophore (rhodamine) | 15937518 |
| 1809 | RRRRRRRRRRR | R11 | 11 | L | Linear | Synthetic | Cationic | Conjugation with rhodamine B | Free | NA | Fluorophore (rhodamine) | 15937518 |
| 1810 | RRRRRRRRRRRTYADFIASGRTGRRNAI | R11-PKI | 28 | L | Linear | Chimeric | Unknown | Conjugation with rhodamine B | Free | NA | Fluorophore (rhodamine) | 15937518 |
| 1811 | RRRRRRRRR | R9 | 9 | L | Linear | Synthetic | Cationic | Conjugation with rhodamine B | Amidation | NA | Fluorophore (fluorescein) | 21867915 |
| 1812 | RRRRRRRRR | R9 | 9 | L | Linear | Synthetic | Cationic | Conjugation with rhodamine B | Amidation | NA | Fluorophore (fluorescein) | 21867915 |
| 1813 | RRRRRRRRR | R9 | 9 | L | Linear | Synthetic | Cationic | Conjugation with rhodamine B | Amidation | NA | Fluorophore (fluorescein) | 21867915 |
| 1820 | RQIKIWFQNRRMKWKK | Penetratin {pAntp-(43-58)} | 16 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (fluorescein) | 21867915 |
| 1821 | RQIKIWFQNRRMKWKK | Penetratin {pAntp-(43-58)} | 16 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (fluorescein) | 21867915 |
| 1824 | KCFQWQRNMRKVRGPPVSCIKR | hLF(38-59) peptide | 22 | L | Linear | Protein derived | Unknown | Conjugation with fluorescein | Amidation | NA | Fluorophore (fluorescein) | 21867915 |