ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
---|---|---|---|---|---|---|---|---|---|---|---|---|
2407 | Ac-WELVVL-YGRKKRRQRRR | Ac-pep5-cpp | 17 | L | Linear | Synthetic | Cationic | Acetylation | Free | NA | Peptide [Pep-5 (WELVVL)] | 24764300 |
2447 | RRIRPRPPRLPRPRPRPLPFPRPG | p21-ELP1-Bac | 24 | L | Linear | Synthetic | NA | Conjugated with p21-ELP1 | Free | NA | Peptide (p21-ELP) | 24680816 |
2531 | RRGRRG | V1 | 6 | L | Linear | Synthetic | Cationic | Conjugated to FITC modified folding domain via β-alanine–glycine– glycine linker | Amidation | NA | Peptide (FITC labelled peptide) | 25524829 |
2532 | RRRRRR | V2 | 6 | L | Linear | Synthetic | Cationic | Conjugated to FITC modified folding domain via β-alanine–glycine– glycine linker | Amidation | NA | Peptide (FITC labelled peptide) | 25524829 |
2533 | RRRRRR | V2R | 6 | L | Linear | Synthetic | Cationic | Conjugated to FITC modified folding domain via β-alanine–glycine– glycine linker | Amidation | NA | Peptide (FITC labelled peptide) | 25524829 |
2549 | MRRIRPRPPRLPRPRPRPLPFPRPGGCYPG | Bac-ELP-H1 | 30 | L | Linear | Protein derived | Cationic | Free | Conjugation with ELP-Rho | NA | Peptide (Rhodamine labeled ELP) | 23372821 |
2550 | RGGRLSYSRRRFSTSTGRA | SynB1-ELP-H1 | 19 | L | Linear | Protein derived | Amphipathic | Free | Conjugation with ELP-Rho | NA | Peptide (Rhodamine labeled ELP) | 23372821 |
2551 | YGRKKRRQRRR | ST1-104 | 11 | L | Linear | Protein derived | Cationic | Free | Conjugation with CBD3 peptide of CRMP2 | NA | Peptide [Ca2+ channel binding domain 9CBD3)] | 23106100 |
2552 | YGRKKRRQRRR | ST9-104 | 11 | L | Linear | Protein derived | Cationic | Free | Conjugation with reverse sequence of CBD3 peptide of CRMP2 | NA | Peptide [Ca2+ channel binding domain 9CBD3)] | 23106100 |
2553 | RRRRRRRRR | ST2-104 | 9 | L | Linear | Synthetic | Cationic | Free | Conjugation with CBD3 peptide of CRMP2 | NA | Peptide [Ca2+ channel binding domain 9CBD3)] | 23106100 |
2554 | RRRRRRRRR | FITC-ST2-104 | 9 | L | Linear | Synthetic | Cationic | Conjugation with FITC | Conjugation with CBD3 peptide of CRMP2 | NA | Peptide [Ca2+ channel binding domain 9CBD3)] and Fluorophore (FITC) | 23106100 |
2560 | CRQIKIWFQNRRMKWKK | KLA-Pen | 17 | L | Linear | Chimeric | Cationic | Conjugated with KLA | Amidation | NA | Peptide (KLA), Nanoparticle (liposome) | 24796502 |
2576 | RGGRLSYSRRRFSTSTGR | Synb1-ELP-PKI | 18 | L | Linear | Synthetic | NA | Free | Free | NA | Peptide (PKA inhibitory peptide) | 24903464 |
2578 | RGGRLSYSRRRFSTSTGR | Synb1-ELP-TRTK | 18 | L | Linear | Synthetic | NA | Free | Free | NA | Peptide (S100B inhibitory peptide) | 24903464 |
2658 | RRRRRRRR | M Peptide 8F-L | 8 | L | Linear | Synthetic | Cationic | Conjugation with HIV inhibiting peptide | Amidation | GABA spacer | Peptide (HIV inhibiting peptide) | 22277590 |
2659 | RRRRRRRR | M Peptide 14F-L | 8 | L | Linear | Synthetic | Cationic | Conjugation with HIV inhibiting peptide | Amidation | GABA spacer | Peptide (HIV inhibiting peptide) | 22277590 |
2701 | rrrrrrrrrrrr | dR12-p53C' | 12 | D | Linear | Synthetic | Cationic | NA | Amidation | NA | Peptide (cyclin-dependent kinase inhibitor) | 22486588 |
2702 | RRRRRRRRR | R8-p27kip1C | 9 | L | Linear | Synthetic | Cationic | NA | Amidation | NA | Peptide (cyclin-dependent kinase inhibitor) | 22486588 |
2703 | FFLIPKGRRRRRRRRGC | PasR8-p27kip1C | 17 | L | Linear | Synthetic | Cationic | NA | Amidation | NA | Peptide (cyclin-dependent kinase inhibitor) | 22486588 |
2704 | FFFFGRRRRRRRRGC | F4R8--p27kip1C | 15 | L | Linear | Synthetic | Cationic | NA | Amidation | NA | Peptide (cyclin-dependent kinase inhibitor) | 22486588 |
2705 | RRRRRRRRR | R8-PAD | 9 | L | Linear | Synthetic | Cationic | NA | Amidation | NA | Peptide [(Proapoptotic domain (PAD)] | 22486588 |
2706 | FFLIPKGRRRRRRRRGC | PasR8-PAD | 17 | L | Linear | Synthetic | Cationic | NA | Amidation | NA | Peptide [(Proapoptotic domain (PAD)] | 22486588 |
2707 | FFFFGRRRRRRRRGC | F4R8-PAD | 15 | L | Linear | Synthetic | Cationic | NA | Amidation | NA | Peptide [(Proapoptotic domain (PAD)] | 22486588 |
2713 | YGRKKRRQRRRGTALDWSWLQTE | TAT-NBD | 23 | L | Linear | Synthetic | NA | NA | NA | NA | Peptide (TMTP1) | 22580115 |
2714 | CGNVVRQGC-G-YGRK-KRRQRRR-G-TALDWSWLQTE | TMTP1-TAT-NBD | 33 | L | Linear | Synthetic | NA | NA | NA | NA | Peptide (TMTP1) | 22580115 |
2774 | GIGKFLHSAKKFGKAFVGEIMNSGGKKWKMRRNQFWVKVQRG | MG2A | 42 | L | Linear | Synthetic | NA | Free | Free | NA | Peptide (Antmicrobial peptide MG2) | 23286306 |
2818 | GRKKRRERRRPPERKCX | Tat | 17 | L | Linear | Protein derived | Cationic | Free | Free | NA | Peptide [VP1 BC loop (V) peptides] | 23802147 |