Browse result page of AntiTbPdb
The total number entries retrieved from this search are 738
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1371 | Mycobacterial tuberculosis DHFR tripeptide analog | WYD | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.26 × 10−7 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1372 | Mycobacterial tuberculosis DHFR tripeptide analog | WYE | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 5.02 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1373 | Mycobacterial tuberculosis DHFR tripeptide analog | WPD | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 9.12 × 10−9 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1374 | Mycobacterial tuberculosis DHFR tripeptide analog | WPE | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.02 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1375 | Mycobacterial tuberculosis DHFR tripeptide analog | YPD | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 4.17 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1376 | Mycobacterial tuberculosis DHFR tripeptide analog | YPE | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 2.75 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1377 | Mycobacterial tuberculosis DHFR tripeptide analog | WYY | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.78 × 10−9 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1378 | Mycobacterial tuberculosis DHFR tripeptide analog | WPY | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 9.55 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1379 | Mycobacterial tuberculosis DHFR tripeptide analog | WYP | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 4.57 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1380 | Mycobacterial tuberculosis DHFR tripeptide analog | WPW | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 4.27 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1381 | Mycobacterial tuberculosis DHFR tripeptide analog | WYW | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.45 × 10−7 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1382 | Mycobacterial tuberculosis DHFR tripeptide analog | WYS | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.44 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1383 | Mycobacterial tuberculosis DHFR tripeptide analog | WPS | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 7.94 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1384 | Mycobacterial tuberculosis DHFR tripeptide analog | WPT | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 2.95 × 10−7 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1385 | Mycobacterial tuberculosis DHFR tripeptide analog | WYT | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 3.31 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1386 | Mycobacterial tuberculosis DHFR tripeptide analog | YPS | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 8.91 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1387 | Mycobacterial tuberculosis DHFR tripeptide analog | YPT | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 6.46 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1388 | Hepcidin | DTHFPICIFCCGCCHRSKCGMCCKT | Free | Free | Disulphide linkage between cys7-23, cys10-13, cys11-19,cys14-22 | Cyclic | 25 | L | Cationic | Natural | Human alveolar type 2 epithilium | Mycobacterium tuberculosis | Mycobacterium H37Rv | NA | in vivo | A549 cell line | NA | No cytotoxicity | BALB/C | NA | Increased production of TNF-α, IL-1α | NA | Mycobacterium tuberculosis + IFN-Υ | antimicrobial | 2011 | 21482189 | |
| antitb_1389 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml | in vitro | J774.A1 macrophage cell lines | 14% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1390 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml (after 6 hours) | in vitro | J774.A1 macrophage cell lines | 34% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1391 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg/ml | in vitro | J774.A1 macrophage cell lines | 41% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1392 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg /ml (after 6 hours incubation) | in vitro | J774.A1 macrophage cell lines | 67% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1393 | GEK-31 | RKSKEKIGKEFKRIVQR IKDFLRNLVPRTES | Free | Free | None | Linear | 33 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | NA | in vitro | J774.A1 macrophage cell lines | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1394 | LL-18 | KEFKRIVQRIKDFLRNLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | NA | in vitro | J774.A1 macrophage cell lines | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1395 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml | in vitro | J774.A1 macrophage cell lines | 67% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1396 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml (after 6 hours) | in vitro | J774.A1 macrophage cell lines | 89% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1397 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg/ml | in vitro | J774.A1 macrophage cell lines | 81% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1398 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg /ml (after 6 hours incubation) | in vitro | J774.A1 macrophage cell lines | 98% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1399 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria bovis | Mycobacteria bovis BCG | MIC = 25μg/ml | in vitro | THP-1 cells | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1400 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria bovis | Mycobacteria bovis BCG | MIC = 25μg /ml (after 624hours incubation) | in vitro | THP-1 cells | > 60% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1401 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml | in vitro | J774.A1 macrophage cell lines | 51% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1402 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg/ml | in vitro | J774.A1 macrophage cell lines | 80% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1403 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 25μg/ml (24 hours incubation) | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1404 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 100 μg/mL (72 hours incubation) | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1405 | D-LAK120 | KKLALLALKKWLLALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis susceptible strain | NA | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1406 | D-LAK120 | KKLALLALKKWLLALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | MIC = 50 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1407 | D-LAK120-P13 | KKLALLALKKWLPALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | MIC = 100 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1408 | D-LAK120-A | KKLALALAKKWLALAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | MIC = 25 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1409 | D-LAK120-HP13 | KKALAHALKKWLPALKKLAHALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | MIC = 25 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1410 | D-LAK120-H | KKLALHALKKWLHALKKLAHLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | NA | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1411 | D-LAK120 | KKLALLALKKWLLALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | MIC = 50 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1412 | D-LAK120-P13 | KKLALLALKKWLPALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | MIC = 100 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1413 | D-LAK120-A | KKLALALAKKWLALAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | MIC = 100 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1414 | D-LAk120-AP13 | KKLALALAKKWLPLAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1415 | D-LAK120-H | KKLALHALKKWLHALKKLAHLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | MIC = 100 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1416 | D-LAK120-HP13 | KKALAHALKKWLPALKKLAHALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | 50 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1417 | D-LAK120 | KKLALLALKKWLLALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | THP-1 cell line | EC50(effective concentration) =14.4 ± 3.3 μM | No cytotoxicity | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1418 | D-LAK120-P13 | KKLALLALKKWLPALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | THP-1 cell line | EC50 =17.9 ± 1.7 μM | No cytotoxicity | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1419 | D-LAK120-A | KKLALALAKKWLALAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | THP-1 cell line | EC50 = 31.9 ± 9.5 μM | Cytotoxic at > 25 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
| antitb_1420 | D-LAk120-AP13 | KKLALALAKKWLPLAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | THP-1 cell line | EC50 = 32.1 ± 4.8 μM | Cytotoxic at > 25 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |