Browse result page of AntiTbPdb
The total number entries retrieved from this search are 650
ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
antitb_1390 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml (after 6 hours) | in vitro | J774.A1 macrophage cell lines | 34% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1391 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg/ml | in vitro | J774.A1 macrophage cell lines | 41% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1392 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg /ml (after 6 hours incubation) | in vitro | J774.A1 macrophage cell lines | 67% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1393 | GEK-31 | RKSKEKIGKEFKRIVQR IKDFLRNLVPRTES | Free | Free | None | Linear | 33 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | NA | in vitro | J774.A1 macrophage cell lines | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1394 | LL-18 | KEFKRIVQRIKDFLRNLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | NA | in vitro | J774.A1 macrophage cell lines | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1395 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml | in vitro | J774.A1 macrophage cell lines | 67% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1396 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml (after 6 hours) | in vitro | J774.A1 macrophage cell lines | 89% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1397 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg/ml | in vitro | J774.A1 macrophage cell lines | 81% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1398 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg /ml (after 6 hours incubation) | in vitro | J774.A1 macrophage cell lines | 98% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1399 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria bovis | Mycobacteria bovis BCG | MIC = 25μg/ml | in vitro | THP-1 cells | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1400 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria bovis | Mycobacteria bovis BCG | MIC = 25μg /ml (after 624hours incubation) | in vitro | THP-1 cells | > 60% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1401 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml | in vitro | J774.A1 macrophage cell lines | 51% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1402 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg/ml | in vitro | J774.A1 macrophage cell lines | 80% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1403 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 25μg/ml (24 hours incubation) | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1404 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 100 μg/mL (72 hours incubation) | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
antitb_1405 | D-LAK120 | KKLALLALKKWLLALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis susceptible strain | NA | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1406 | D-LAK120 | KKLALLALKKWLLALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | MIC = 50 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1407 | D-LAK120-P13 | KKLALLALKKWLPALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | MIC = 100 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1408 | D-LAK120-A | KKLALALAKKWLALAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | MIC = 25 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1409 | D-LAK120-HP13 | KKALAHALKKWLPALKKLAHALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | MIC = 25 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1410 | D-LAK120-H | KKLALHALKKWLHALKKLAHLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain | NA | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1411 | D-LAK120 | KKLALLALKKWLLALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | MIC = 50 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1412 | D-LAK120-P13 | KKLALLALKKWLPALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | MIC = 100 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1413 | D-LAK120-A | KKLALALAKKWLALAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | MIC = 100 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1414 | D-LAk120-AP13 | KKLALALAKKWLPLAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1415 | D-LAK120-H | KKLALHALKKWLHALKKLAHLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | MIC = 100 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1416 | D-LAK120-HP13 | KKALAHALKKWLPALKKLAHALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | 50 μM | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1417 | D-LAK120 | KKLALLALKKWLLALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | THP-1 cell line | EC50(effective concentration) =14.4 ± 3.3 μM | No cytotoxicity | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1418 | D-LAK120-P13 | KKLALLALKKWLPALKKLALLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | THP-1 cell line | EC50 =17.9 ± 1.7 μM | No cytotoxicity | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1419 | D-LAK120-A | KKLALALAKKWLALAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | THP-1 cell line | EC50 = 31.9 ± 9.5 μM | Cytotoxic at > 25 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1420 | D-LAk120-AP13 | KKLALALAKKWLPLAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | THP-1 cell line | EC50 = 32.1 ± 4.8 μM | Cytotoxic at > 25 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1421 | D-LAK120-H | KKLALHALKKWLHALKKLAHLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | THP-1 cell line | EC50 = 32.2 ± 5.5 μM | Cytotoxic at12.5 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1422 | D-LAK120-HP13 | KKALAHALKKWLPALKKLAHALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain | NA | in vitro | THP-1 cell line | EC50 = 32.3 ± 4.7 μM | Cytotoxic above 3.13 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1423 | D-LAK120-H | KKLALHALKKWLHALKKLAHLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain GB2 | NA | Ex vivo | THP-1 cell line | NA | Cytotoxic at > 25 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1424 | D-LAK120-HP13 | KKALAHALKKWLPALKKLAHALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain GB2 | NA | Ex vivo | THP-1 cell line | NA | Cytotoxic at > 25 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1425 | D-LAK120-A | KKLALALAKKWLALAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain GB2 | NA | Ex vivo | THP-1 cell line | NA | Cytotoxic at12.5 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1426 | D-LAk120-AP13 | KKLALALAKKWLPLAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR strain GB2 | NA | Ex vivo | THP-1 cell line | NA | Cytotoxic above 3.13 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1427 | D-LAK120-H | KKLALHALKKWLHALKKLAHLALKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain WYC-11 | NA | Ex vivo | THP-1 cell line | NA | Cytotoxic at > 25 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1428 | D-LAK120-HP13 | KKALAHALKKWLPALKKLAHALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain WYC-11 | NA | Ex vivo | THP-1 cell line | NA | Cytotoxic at > 25 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1429 | D-LAK120-A | KKLALALAKKWLALAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain WYC-11 | NA | Ex vivo | THP-1 cell line | NA | Cytotoxic at12.5 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1430 | D-LAk120-AP13 | KKLALALAKKWLPLAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain WYC-11 | NA | Ex vivo | THP-1 cell line | NA | Cytotoxic above 3.13 μM | NA | NA | NA | NA | NA | NA | NA | 2014 | 25154927 |
antitb_1431 | D-LAk120-AP13 | KKLALALAKKWLPLAKKLALALAKK | Free | Free | None | Linear | 25 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis XDR strain WYC-11 | MIC = 3.13 μM | In vitro | THP-1 cell line | NA | NA | NA | NA | NA | NA | NA | INH+D-LAK120-HP13 | NA | 2014 | 25154927 |
antitb_1432 | Viomycin | H2N-CH-CH-CH-CH-R1-CH-NH2-Ch-CO-Nh-C-CO-NH-CH2OH-CO-NH-CH(CH2OH)-CO-NH-R2-CO-R3-HN-CH | Free | Free | R1=H, R2= >C=CHNHCONH2, R3=Tbd (Tuberactin) | NA | 38 | NA | NA | NA | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis 607 | MIC = 1.6 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against Bacillus subtilis, Pseudomonas aeruginosa, proteus vulgaris, satphylococus aureous | 1977 | 197067 |
antitb_1433 | Tuberactinomycin | H2N-CH-CH-CH-CH-R1-CH-NH2-Ch-CO-Nh-C-CO-NH-CH2OH-CO-NH-CH(CH2OH)-CO-NH-R2-CO-R3-HN-CH | Free | Free | R1 = OH, R2= >C=CHNHCONH2, R3 = Tbd (tuberactidine) | NA | 38 | NA | NA | NA | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis 607 | MIC = 3.1 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against Bacillus subtilis, Pseudomonas aeruginosa, proteus vulgaris, satphylococus aureous | 1977 | 197067 |
antitb_1434 | Tuberactinomycin O | H2N-CH-CH-CH-CH-R1-CH-NH2-Ch-CO-Nh-C-CO-NH-CH2OH-CO-NH-CH(CH2OH)-CO-NH-R2-CO-R3-HN-CH | Free | Free | R1 = H, R2 = >C=CHNHCONH2, R3 =Cpd (Capreomycidine) | NA | 38 | NA | NA | NA | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis 607 | MIC = 1.6 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against Bacillus subtilis, Pseudomonas aeruginosa, proteus vulgaris, satphylococus aureous | 1977 | 197067 |
antitb_1435 | Dihydroviomycin | H2N-CH-CH-CH-CH-R1-CH-NH2-Ch-CO-Nh-C-CO-NH-CH2OH-CO-NH-CH(CH2OH)-CO-NH-R2-CO-R3-HN-CH | Free | Free | None | NA | 38 | NA | NA | NA | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis 607 | MIC = 6.2 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against Bacillus subtilis, Pseudomonas aeruginosa, proteus vulgaris, satphylococus aureous | 1977 | 197067 |
antitb_1436 | Tetrahydroviomycin | H2N-CH-CH-CH-CH-R1-CH-NH2-Ch-CO-Nh-C-CO-NH-CH2OH-CO-NH-CH(CH2OH)-CO-NH-R2-CO-R3-HN-CH | Free | Free | R1 = H, r2 = >CH-OH, R3=Tbd(Tuberactidine) | NA | 38 | NA | NA | NA | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis 607 | MIC = 3.1 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against Bacillus subtilis, Pseudomonas aeruginosa, proteus vulgaris, satphylococus aureous | 1977 | 197067 |
antitb_1437 | Oxoviomycin | H2N-CH-CH-CH-CH-R1-CH-NH2-Ch-CO-Nh-C-CO-NH-CH2OH-CO-NH-CH(CH2OH)-CO-NH-R2-CO-R3-HN-CH | Free | Free | R1= H, R2 = > c=o, R3 = Tbd (Tuberactidine) | NA | 38 | NA | NA | NA | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis 607 | NA | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against Bacillus subtilis, Pseudomonas aeruginosa, proteus vulgaris, satphylococus aureous | 1977 | 197067 |
antitb_1438 | Broxoviomycin | H2N-CH-CH-CH-CH-R1-CH-NH2-Ch-CO-Nh-C-CO-NH-CH2OH-CO-NH-CH(CH2OH)-CO-NH-R2-CO-R3-HN-CH | Free | Free | R1 = H, r2 = >CH-OH, R3=Tbd(Tuberactidine) | NA | 38 | NA | NA | NA | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis 607 | MIC = 800 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against Bacillus subtilis, Pseudomonas aeruginosa, proteus vulgaris, satphylococus aureous | 1977 | 197067 |
antitb_1439 | A2-TB10.4 | IMYNYPAML | Free | Free | None | Linear | 9 | L | NA | Protein derived | MTB derived protein TB10.4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis Rv | NA | NA | NA | NA | NA | NA | NA | IL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatment | Drug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. | CD8+ T-cell | NA | NA | 2104 | 25809751 |