| 1041 | Trauma induced immunosuppressive glycopeptide (TP) | not available | 0 | NA | NA | NA | NA | NA | Natural | From arterial blood of burn or trauma patient | neutrophils, T and B Lymphocytes | Through stimulation of PGE2 biosynthesis and through a non-cyclooxygenasepathway. | In vitro | Mitomycin-treated stimulator Lymphocytes | NA | NA | Mixed Lymphocyte culture assay and TP-induced PGE2 biosynthesis assay | NA | NA | 2965105 | 1988 |
| 1075 | CKS-17 | LQNRRGLDLLFLKEGGL | 17 | L | None | Conjugated to HSA (human serum albumin) | None | Linear | Synthetic | Homologous region found in the transmembrane envelope proteins of murine, feline, and human retro- viruses HTLV-1 and HTLV-2, and an endogenous C-type human retrovirus | Lymphocyte | Inhibits the Proliferation of Purified Lymphocytes | In vitro | Mononuclear Cells, Lymphocytes, Human Neutrophils, Lymphoblastoid cell line-Jurkat cell, | 10 micromolar in Lymphocyte proliferation assays | None | Lymphocyte Proliferation assay | NA | NA | 1921761 | 1991 |
| 1202 | A1HS1 | II-Sta-PYVPL | 8 | L | None | None | Sta = (3S, 4S) -4- amino-3-hydroxy-6-methyl-heptanoic acid(C8H17NO3) | Cyclic | Synthetic | NA | Lymphocytes, Macrophages | Influence of phagocytic function of macrophages, and the retarding effect of the proliferation of Lymphocytes | Both | Spleen Lymphocyte | NA | BALB / C mice | Delayed-type hypersensitivity (DTH) test, Lymphocyte Proliferation test, MTT | NA | | CN 101289499 B | 2010 |
| 1203 | A3HS1 | IIPPYV-Sta-L | 8 | L | None | None | Sta = Statine | Cyclic | Synthetic | NA | Lymphocytes, Macrophages | Influence of phagocytic function of macrophages, and the retarding effect of the proliferation of Lymphocytes | Both | Spleen Lymphocyte | NA | BALB / C mice | Delayed-type hypersensitivity (DTH) test, Lymphocyte Proliferation test, MTT | NA | | CN 101289498 B | 2010 |
| 1204 | A4HS1 | II-Sta-Sta-YVPL | 8 | L | None | None | Sta = Statine | Cyclic | Synthetic | NA | Lymphocytes, Macrophages | Influence of phagocytic function of macrophages, and the retarding effect of the proliferation of Lymphocytes | Both | Spleen Lymphocyte | NA | BALB / C mice | Delayed-type hypersensitivity (DTH) test, Lymphocyte Proliferation test, MTT | NA | | CN 101289497 A | 2008 |
| 1220 | NA | CVRGLYIDFRKDLGWK | 16 | L | None | None | None | Linear | Synthetic | Retro virus | Lymphocytes, TGF | Inhibits cell proliferation, conjugated polypeptide block the binding of TGF-B to its receptor | Both | Mu-I-Lv | NA | DBA/IJ male mice | Thymidine incorporation assay, TGF-fi Radioreceptor Binding Assay, Mice arthritis model | NA | Coupled to carrier proteins or crosslinked to form polymers | CA2057896C | 2000 |
| 1221 | Aalpha (SEQ ID NO 12) | ERHQSACKDSDWPFCSDEDWNYK | 23 | L | None | None | None | Linear | Protein Derived | Alpha chain of the fibrin | Lymphocyte | Suppress increase in inflammatory cells, Aalpha Gly Pro Arg (Pro) - NH 2 acetate (Aalpha derivative) short peptide is equally effective as the long peptides in appropriate continuous addition at inhibiting monocyte migration | In vivo | PBMC | NA | HU-SCID mouse model | NA | NA | NA | WO 2002048180 A2 | 2002 |
| 1222 | Bbeta (SEQ ID NO 11) | DKRKEEAPSLRPAPPPISGGGYR | 23 | L | None | None | None | Linear | Protein Derived | Beta chain of the fibrin | Lymphocyte | Inhibition of Lymphocyte migration, blocks the lymphocytic inflammation, Bbeta Gly His Arg Pro-OH acetate (Bbeta derivative) short peptide is equally effective as the long peptides in appropriate continuous addition at inhibiting monocyte migration | In vivo | PBMC | NA | HU-SCID mouse model | NA | NA | NA | WO 2002048180 A2 | 2002 |
| 1375 | SEQ ID2 | SCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 34 | L | None | None | N-acetylation at position 18 | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1376 | SEQ ID3 | CIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 33 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1377 | SEQ ID4 | RSCIDTIPKSECTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | N-acetylation at position 19 | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1378 | SEQ ID5 | RSCIDTIPKSRCTAFECKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1379 | SEQ ID6 | RSCIDTIPKSRCTAFQCKKSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1380 | SEQ ID7 | RSCIDTIPKSRCTAFQCKHSMEYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1381 | SEQ ID8 | RSCIDTIPKSRCTAFQCKHSMKXYRLSFCRKTCGTC | 36 | L | None | None | X = cyclohexylalanine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1382 | SEQ ID9 | RSCIDTIPKSRCTAFQCKHSMAYRLSXCRKTCGTC | 35 | L | None | None | X = cyclohexylalanine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1383 | SEQ ID10 | RSCATIPKSRCTAAQCKHSMKYRLSFCRKRCGTC | 34 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1384 | SEQ ID11 | RSCIDSTIPKSRCTAAQKHSMKYRASFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1385 | SEQ ID12 | RSCADTIPKSRCTAAQCKHSMKYRASFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1386 | SEQ ID13 | SSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1387 | SEQ ID14 | RSCIDTIPQSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1388 | SEQ ID15 | RSCIDTIPKSQCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1389 | SEQ ID16 | RSCIDTIPKSRCTAAQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1390 | SEQ ID17 | RSCIDTIPKSQCTAWQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1391 | SEQ ID18 | RSCIDTIPKSQCTAFQCAHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1392 | SEQ ID19 | RSCIDTIPKSQCTAFQCKHSXKYRLSFCRKTCGTC | 35 | L | None | None | X = norleucine (nL) | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1393 | SEQ ID20 | RSCIDTIPKSRCTAFQCKHSMAYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1394 | SEQ ID21 | RSCIDTIPKSRCTAFQCKHSMXYRLSFCRKTCGTC | 35 | L | None | None | X = norleucine (nL) | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1395 | SEQ ID22 | RSCIDTIPKSRCTAFQCKHSMXYRLSFCRKTCGTC | 35 | L | None | None | X = ornithine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1396 | SEQ ID23 | RSCIDTIPKSRCTAFQCKHSMXYRLSFCRKTCGTC | 35 | L | None | None | X = homocitrulline | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1397 | SEQ ID24 | RSCIDTIPKSRCTAFQCRHSMRYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1398 | SEQ ID25 | RSCIDTIPKSRCTAFQCKHSMKFRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1399 | SEQ ID26 | RSCIDTIPKSRCTAFQCKHSMKXRLSFCRKTCGTC | 35 | L | None | None | X = nitrophenylalanine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1400 | SEQ ID27 | RSCIDTIPKSRCTAFQCKHSMKXRLSFCRKTCGTC | 35 | L | None | None | X = aminophenylalanine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1401 | SEQ ID28 | RSCIDTIPKSRCTAFQCKHSMKYALSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1402 | SEQ ID29 | ASCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1403 | SEQ ID30 | RACIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1404 | SEQ ID31 | RSCADTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1405 | SEQ ID32 | RSCIATIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1406 | SEQ ID33 | RSCIDAIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1407 | SEQ ID34 | RSCIDTAPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1408 | SEQ ID35 | RSCIDTIAKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1409 | SEQ ID36 | RSCIDTIPASRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1410 | SEQ ID37 | RSCIDTIPKARCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1411 | SEQ ID38 | RSCIDTIPKSACTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1412 | SEQ ID39 | RSCIDTIPKSRCAAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1413 | SEQ ID40 | RSCIDTIPKSRCTAAQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1414 | SEQ ID41 | RSCIDTIPKSRCTAFACKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1415 | SEQ ID42 | RSCIDTIPKSRCTAFQCAHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
| 1416 | SEQ ID43 | RSCIDTIPKSRCTAFQCKASMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
