Browse result page of ImmunoSPdb

The total number entries retrieved from this search are 68

ID	Name	Sequence	Length	Chirality	N-Terminal Modification	C-Terminal Modification	Chemical Modification	Linear/Cyclic	Nature	Source	Target	Mechanism of Action	In vivo/ In vitro	Cell Line	IC-50	In vivo Model	Assay Type	Lethal Dose	Combination Therapy	Pubmed ID	Year of Publication
1417	SEQ ID44	RSCIDTIPKSRCTAFQCKHAMKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1418	SEQ ID45	RSCIDTIPKSRCTAFQCKHSAKYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1419	SEQ ID46	RSCIDTIPKSRCTAFQCKHSMAYRLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1420	SEQ ID47	RSCIDTIPKSRCTAFQCKHSMKARLSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1421	SEQ ID48	RSCIDTIPKSRCTAFQCKHSMKYALSFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1422	SEQ ID49	RSCIDTIPKSRCTAFQCKHSMKYRASFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1423	SEQ ID50	RSCIDTIPKSRCTAFQCKHSMKYRLAFCRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1424	SEQ ID51	RSCIDTIPKSRCTAFQCKHSMKYRLSACRKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1425	SEQ ID52	RSCIDTIPKSRCTAFQCKHSMKYRLSFCAKTCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1426	SEQ ID53	RSCIDTIPKSRCTAPQCKHSMKYRLSFCRATCGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1427	SEQ ID54	RSCIDTIPKSRCTAPQCKHSMKYRLSFCRKACGTC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1428	SEQ ID55	RSCIDTIPKSRCTAPQCKHSMKYRLSFCRKTCGAC	35	L	None	None	None	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1429	SEQ ID56	RSCIDTIPKSRCTAFQCKHSMXYRLSFCRKTCGTC	35	L	None	None	X = diaminopropanoic acid	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1430	SEQ ID57	RSCIDTIPKSRCTAFQCKHSMKXRLSFCRKTCGTC	35	L	None	None	X = benzoylphenylalanine	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1431	SEQ ID58	XSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	X = N-acetyl-arginine	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1432	SEQ ID59	RSCIDTIPKSRCTAXQCKHSMKYRLSFCRKTCGTC	35	L	None	None	X = azidophenylalanine	Linear	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1433	SEQ ID60	RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Cyclic (C3-C35, C12	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000
1434	SEQ ID61	RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC	35	L	None	None	None	Cyclic (C3-C35)	Natural	Shk toxin of S.helianthus	T Lymphocytes Kv1.3 channels	By blocking the potassium channel, Kv1.3 of T lymphocytes	Both	Peripheral blood human lymhocytes	1 nM	CD18-nullPL/J mice	Enzyme-linked immunosorbent assay (ELISA), HPLC	NA	Charybdotoxin (ChTX)	US 6077680	2000

previous 12next