Browse result page of CPPsite 2.0
The total number entries retrieved from this search are 391| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1487 | MANLGCWMLVLFVATWSDLGLCKKRPKP | Human Prp (1-28) | 28 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (fluorescein) | 12435392 |
| 1488 | MVKSKIGSWILVLFVAMWSDVGLCKKRPKP | Bovine Prp (1-30) | 30 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (fluorescein) | 12435392 |
| 1490 | RQIKIWFQNRRMKWKK | Penetratin {pAntp-(43-58)} | 16 | L | Linear | Protein derived | Amphipathic | Biotinylation | Amidation | NA | Biotin | 11716681 |
| 1491 | RVIRVWFQNKRCKDKK | pISL | 16 | L | Linear | Protein derived | Amphipathic | Biotinylation | Amidation | NA | Biotin | 11716681 |
| 1495 | RHIKIWFQNRRMKWKK | PDX -1-PTD | 16 | L | Linear | Protein derived | Amphipathic | Conjugation with FITC | Free | NA | Fluorophore (FITC) | 12829640 |
| 1497 | RQIKIWFQNRRMKWKK | Penetratin {pAntp-(43-58)} | 16 | L | Linear | Protein derived | Amphipathic | Free | Conjugation with GFP | NA | Protein (GFP) | 11211880 |
| 1498 | SKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKDR | Fushi- tarazu (254-313) | 60 | L | Linear | Protein derived | Amphipathic | Free | Conjugation with GFP | NA | Protein (GFP) | 11211880 |
| 1499 | EKRPRTAFSSEQLARLKREFNENRYLTTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKST | Engrailed (454-513) | 61 | L | Linear | Protein derived | Amphipathic | Free | Conjugation with GFP | NA | Protein (GFP) | 11211880 |
| 1501 | GALFLGFLGAAGSTMGAWSQPKKKRKV | P(beta) | 27 | L | Linear | Chimeric | Amphipathic | Acetylation | Cysteamide group | NA | NA | 15461515 |
| 1502 | GALFLAFLAAALSLMGLWSQPKKKRRV | P(alpha) | 27 | L | Linear | Chimeric | Amphipathic | Acetylation | Cysteamide group | NA | NA | 15461515 |
| 1506 | GLRKRLRKFRNKIKEK | Sc18 | 16 | L | Linear | Protein derived | Cationic amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (fluorescein) | 0 |
| 1509 | VRLPPP | PolyP 1 | 6 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1510 | VRLPPPVRLPPP | PolyP 2 | 12 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1511 | VRLPPPVRLPPPVRLPPP | PolyP 3 (SAP) | 18 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1512 | VHLPPP | PolyP 4 | 6 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1513 | VHLPPPVHLPPP | PolyP 5 | 12 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1514 | VHLPPPVHLPPPVHLPPP | PolyP 6 | 18 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1515 | VKLPPP | PolyP 7 | 6 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1516 | VKLPPPVKLPPP | PolyP 8 | 12 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1517 | VKLPPPVKLPPPVKLPPP | PolyP 9 | 18 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 15054781 |
| 1518 | RQIKIWFQNRRMKWKK | Penetratin {pAntp-(43-58)} | 16 | L | Linear | Protein derived | Amphipathic | Conjugation with hca (4-(7-hydroxycoumaryl)-acetyl) | Amidation | NA | Fluorophore [hca (4-(7-hydroxycoumaryl)-acetyl)] | 19552459 |
| 1519 | RQIKIFFQNRRMKWKK | pAntp mutant | 16 | L | Linear | Protein derived | Amphipathic | Conjugation with hca (4-(7-hydroxycoumaryl)-acetyl) | Amidation | NA | Fluorophore [hca (4-(7-hydroxycoumaryl)-acetyl)] | 19552459 |
| 1522 | DPKGDPKGVTVTVTVTVTGKGDPKPD | VT5 | 26 | L | Linear | Synthetic | Amphipathic | Conjugation with fluorescein | NA | NA | Fluorophore (fluorescein) | 9350995 |
| 1533 | LIRLWSHLIHIWFQNRRLKWKKK | EB-1 | 23 | L | Linear | Protein derived | Amphipathic | NA | Amidation | NA | Nucleic acid (siRNA) | 17463227 |
| 1541 | WEAKLAKALAKALAKHLAKALAKALKACEA | KALA | 30 | L | Linear | Synthetic | Cationic amphipathic | NA | NA | NA | Nucleic acid | 9062132 |
| 1542 | MGLGLHLLVLAAALQGAWSQPKKKRKV | Peptide 1 | 27 | L | Linear | Chimeric | Amphipathic | Acetylation | Cysteamide group | NA | NA | 9287160 |
| 1543 | MGLGLHLLVLAAALQGAKKKRKV | Peptide 2 | 23 | L | Linear | Chimeric | Amphipathic | Acetylation | Cysteamide group | NA | NA | 9287160 |
| 1544 | WEAALAEALAEALAEHLAEALAEALEALAA | GALA | 30 | L | Linear | Synthetic | Amphipathic | Conjugation with FITC | NA | NA | Fluorophore (FITC) | 19388672 |
| 1545 | GLFEALLELLESLWELLLEA | JST-1 | 20 | L | Linear | Synthetic | Amphipathic | NA | NA | NA | Nucleic acid | 9156807 |
| 1546 | GLFKALLKLLKSLWKLLLKA | ppTG1 | 20 | L | Linear | Synthetic | Amphipathic | NA | NA | NA | Nucleic acid | 11829517 |
| 1792 | AHALCLTERQIKIWFQNRRMKWKKEN | pAntpHD | 26 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 8105471 |
| 1793 | AHALCPPERQIKIWFQNRRMKWKKEN | pAntpHD 40P2 | 26 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 8105471 |
| 1794 | AYALCLTERQIKIWFANRRMKWKKEN | pAntpHD 50A | 26 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Free | NA | Fluorophore (fluorescein) | 8105471 |
| 1803 | RQIKIWFQNRRMKWKK | Penetratin {pAntp-(43-58)} | 16 | L | Linear | Protein derived | Amphipathic | Conjugation with rhodamine B | Free | NA | Fluorophore (rhodamine) | 15937518 |
| 1807 | AGYLLGKINLKALAALAKKIL | Transportan | 21 | L | Linear | Chimeric | Amphipathic | Conjugation with rhodamine B | Free | NA | Fluorophore (rhodamine) | 15937518 |
| 1820 | RQIKIWFQNRRMKWKK | Penetratin {pAntp-(43-58)} | 16 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (fluorescein) | 21867915 |
| 1821 | RQIKIWFQNRRMKWKK | Penetratin {pAntp-(43-58)} | 16 | L | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (fluorescein) | 21867915 |
| 1822 | rqikiwfqnrrmkwkk | Penetratin {pAntp-(43-58)} | 16 | D | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (fluorescein) | 21867915 |
| 1823 | rqikiwfqnrrmkwkk | Penetratin {pAntp-(43-58)} | 16 | D | Linear | Protein derived | Amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (fluorescein) | 21867915 |
| 1828 | KLALKLALKALKAALKLAGC | MAP | 20 | L | Linear | Synthetic | Amphipathic | Acetylation | Conjugation with fluorescein | NA | Fluorophore (fluorescein) | 21875799 |
| 1829 | KLULKLULKULKAULKLUGC | MAP (Aib) | 20 | Modified | Linear | Synthetic | Amphipathic | Acetylation | Conjugation with fluorescein | Aib, α-amino isobutyric acid | Fluorophore (fluorescein) | 21875799 |