ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
---|---|---|---|---|---|---|---|---|---|---|---|---|
2322 | RKKRRQRRRGGGKLLKLLLKLLLKLLK | TatLK15 | 27 | L | Linear | Chimeric | Cationic and Amphipathic | Free | Amidation | NA | Fluorophore (TAMRA) | 24218116 |
2323 | RQIKIWFQNRRMKWKK | Penetratin (Antennapedia) | 16 | L | Linear | Protein derived | Cationic | Free | Free | NA | Protein (ATTO488-BSA, ?-galactosidase) | 24275947 |
2324 | YGRKKRRQRRR | HIV-TAT (47-57) | 11 | L | Linear | Protein derived | Cationic | Free | Amidation | NA | Protein (ATTO488-BSA, ?-galactosidase) | 24275947 |
2325 | GALFLAFLAAALSLMGLWSQPKKKRKV | MPGα | 27 | L | Linear | Synthetic | Cationic | Acetylation | Cysteamide group | NA | Protein (ATTO488-BSA, ?-galactosidase) | 24275947 |
2326 | GALFLGFLGAAGSTMGAWSQPKKKRKV | MPGβ | 27 | L | Linear | Synthetic | Cationic | Acetylation | Cysteamide group | NA | Protein (ATTO488-BSA, ?-galactosidase) | 24275947 |
2327 | GLWRALWRLLRSLWRLLWKA | CAD-2 (des-acetyl, Lys19-CADY) | 20 | L | Linear | Synthetic | Cationic | Free | Cysteamide group | NA | Protein (ATTO488-BSA, ?-galactosidase) | 24275947 |
2328 | KLPVM | CPPP-2 | 5 | L | Linear | Synthetic | Cationic | Free | Free | NA | Protein (ATTO488-BSA, ?-galactosidase) | 24275947 |
2329 | GD(Abu)LPHLKLC | MCa UF1-9-C-Cy5 | 10 | Modified | Linear | Synthetic | Cationic | Free | Cysteine addition | Abu, isosteric 2-aminobutyric acid | Fluorophore (Cy5) | 24276021 |
2330 | YGRKKRRQRRRC | Tat-C-Cy5 | 12 | L | Linear | Protein derived | Cationic | Free | Cysteine addition | NA | Fluorophore (Cy5) | 24276021 |
2331 | RQIKIWFQNRRMKWKKC | Pen-C-Cy5 | 17 | L | Linear | Protein derived | Cationic and amphipathic | Free | Cysteine addition | NA | Fluorophore (Cy5) | 24276021 |
2332 | RRRRRRRRRC | PolyR-C-Cy5 | 10 | L | Linear | Synthetic | Cationic | Free | Cysteine addition | NA | Fluorophore (Cy5) | 24276021 |
2333 | KLFMALVAFLRFLTIPPTAGILKRWGTI | pepM | 28 | L | Linear | Synthetic | Hydrophobic | Conjugation with rhodamine B | Free | NA | Nucleic acid (ssDNA oligonucleotide labelled with Alexa-488) | 24286593 |
2334 | LKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRR | pepR | 35 | L | Linear | Synthetic | Cationic | Conjugation with rhodamine B | Free | NA | Nucleic acid (ssDNA oligonucleotide labelled with Alexa-488) | 24286593 |
2335 | CELAGIGILTVRKKRRQRRR | Alexa488-Melan-A-TAT | 20 | L | Linear | Chimeric | Cationic | Conjugation with Alexa488 C5 maleimide | Free | NA | Fluorophore (Alexa488) and Protein (ovalbumin) | 24372650 |
2336 | CELAGIGILTVKKKKKQKKK | Alexa488-Melan-A-polyLys (control peptide) | 20 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Alexa488) and Protein (ovalbumin) | 24372650 |
2337 | KKLFKKILKKL | CF-BP16 | 11 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein (CF)] | 24480922 |
2338 | CREKA-KKLFKKILKKL | BP328 | 16 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein (CF)] | 24480922 |
2339 | KKLFKKILKKL | BP326 | 11 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein (CF)], CLB | 24480922 |
2340 | CREKA-KKLFKKILKKL | BP330 | 16 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein (CF)], CLB | 24480922 |
2341 | GRKKRRQRRRPPQK | TAT | 14 | L | Linear | Protein derived | Cationic | Conjugation with 5-carboxyfluorescein via a lysine residue | Free | NA | Fluorophore [5-carboxyfluorescein (FAM)] | 24521351 |
2342 | RQIKIWFQNRRMKWKKK | Penetratin | 17 | L | Linear | Protein derived | Cationic and amphipathic | Conjugation with 5-carboxyfluorescein via a lysine residue | Free | NA | Fluorophore [5-carboxyfluorescein (FAM)] | 24521351 |
2343 | RRRRRRRRK | R8 | 9 | L | Linear | Synthetic | Cationic | Conjugation with 5-carboxyfluorescein via a lysine residue | Free | NA | Fluorophore [5-carboxyfluorescein (FAM)] | 24521351 |
2344 | VSRRRRRRGGRRRRK | Protamine | 15 | L | Linear | Synthetic | Cationic | Conjugation with 5-carboxyfluorescein via a lysine residue | Free | NA | Fluorophore [5-carboxyfluorescein (FAM)] | 24521351 |
2345 | RRRRR | Arg5-ELPBC | 5 | L | Linear | Synthetic | Cationic | Conjugation with ELPBC | Free | NA | Peptide (BH3 peptide drug and ELPBC) | 24611762 |
2346 | RRRRRRRR | Arg8-ELPBC | 8 | L | Linear | Synthetic | Cationic | Conjugation with ELPBC | Free | NA | Peptide (BH3 peptide drug and ELPBC) | 24611762 |
2347 | YGRKKRRQRRR | TAT-ELPBC | 11 | L | Linear | Protein derived | Cationic | Conjugation with ELPBC | Free | NA | Peptide (BH3 peptide drug and ELPBC) | 24611762 |
2348 | YGRGGRRGRRR | RTAT-ELPBC | 11 | L | Linear | Synthetic | Cationic | Conjugation with ELPBC | Free | NA | Peptide (BH3 peptide drug and ELPBC) | 24611762 |
2386 | HEHEHEHEHEHEHEHEEFGGGGGYGRGRGRGRGRGRG | GST-(HE)8EFG5YG(RG)6 | 37 | L | Linear | Synthetic | Cationic | Conjugated with GST | Free | NA | Protein (GST) | 24697211 |
2387 | HEHEHEHEHEHEHEHEHEHEEFGGGGGYGRGRGRGRGRGRG | GST-(HE)10EFG5YG(RG)6 | 41 | L | Linear | Synthetic | Cationic | Conjugated with GST | Free | NA | Protein (GST) | 24697211 |
2388 | HEHEHEHEHEHEHEHEHEHEHEHEEFGGGGGYGRGRGRGRGRGRG | GST-(HE)12EFG5YG(RG)6 | 45 | L | Linear | Synthetic | Cationic | Conjugated with GST | Free | NA | Protein (GST) | 24697211 |
2389 | HEHEHEHEHEHEHEHEEFGGGGGYGRRRRRRGGGGGG | GST-(HE)8EFG5YGR6G6 | 37 | L | Linear | Synthetic | Cationic | Conjugated with GST | Free | NA | Protein (GST) | 24697211 |
2390 | HEHEHEHEHEHEHEHEHEHEEFGGGGGYGRRRRRRGGGGGG | GST-(HE)10EFG5YGR6G6 | 41 | L | Linear | Synthetic | Cationic | Conjugated with GST | Free | NA | Protein (GST) | 24697211 |
2391 | HEHEHEHEHEHEHEHEHEHEHEHEEFGGGGGYGRRRRRRGGGGGG | GST-(HE)12EFG5YGR6G6 | 45 | L | Linear | Synthetic | Cationic | Conjugated with GST | Free | NA | Protein (GST) | 24697211 |
2392 | HEHEHEHEHEHEHEHEHEHEHEHEEFGGGGGYGRKKRRQRRR | GST-(HE)12EFG5-TAT | 42 | L | Linear | Synthetic | Cationic | Conjugated with GST | Free | NA | Protein (GST) | 24697211 |
2393 | WELVVLGKL-YGRKKRRQRRR | pep5-cpp | 20 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 derivative (WELVVLGKL)] | 24764300 |
2394 | ELVVLGKL-YGRKKRRQRRR | N-pep5-cpp | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (ELVVLGKL)] | 24764300 |
2395 | LVVLGKL-YGRKKRRQRRR | N2-pep5-cpp | 18 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (LVVLGKL)] | 24764300 |
2396 | VVLGKL-YGRKKRRQRRR | N3-pep5-cpp | 17 | L | Linear | Synthetic | Cationic | Free | Free | NA | peptide [Pep-5 (VVLGKL)] | 24764300 |
2397 | WELVVLGK-YGRKKRRQRRR | C1-pep5-cpp | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (WELVVLGK)] | 24764300 |
2398 | WELVVLG-YGRKKRRQRRR | C2-pep5-cpp | 18 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (WELVVLG)] | 24764300 |
2399 | WELVVL-YGRKKRRQRRR | C3-pep5-cpp* | 17 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (WELVVL)] | 24764300 |
2400 | WELVV-YGRKKRRQRRR | C4-pep5-cpp | 16 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (WELVV)] | 24764300 |
2401 | WELV-YGRKKRRQRRR | C5-pep5-cpp | 15 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (WELV)] | 24764300 |
2402 | WEL-YGRKKRRQRRR | C6-pep5-cpp | 14 | L | Linear | Synthetic | Cationic | Free | Free | NA | peptide [Pep-5 (WEL)] | 24764300 |
2403 | WE-YGRKKRRQRRR | C7-pep5-cpp | 13 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (WE)] | 24764300 |
2404 | WELVVA-YGRKKRRQRRR | A | 17 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (WELVVA)] | 24764300 |
2405 | WEAVVL-YGRKKRRQRRR | B | 17 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (WEAVVL)] | 24764300 |
2406 | WEAVVA-YGRKKRRQRRR | C | 17 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [Pep-5 (WEAVVA)] | 24764300 |
2407 | Ac-WELVVL-YGRKKRRQRRR | Ac-pep5-cpp | 17 | L | Linear | Synthetic | Cationic | Acetylation | Free | NA | Peptide [Pep-5 (WELVVL)] | 24764300 |
2408 | GLKKLARLFHKLLKLGC | RF | 17 | L | Linear | Synthetic | Amphipathic | Free | Amidation | NA | NA | 24867193 |