Browse result page of AntiTbPdb
The total number entries retrieved from this search are 106
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1970 | CM-II protein, Sarcotoxin IA | GWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATARG | Free | Amidation | None | Linear | 40 | L | Cationic | Natural | NIH-Sape-4, an Embryonic Cell Line of Sarcophaga peregrina | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | >100 μg/ml | In vitro | None | None | NA | NA | None | NA | NA | cell wall (lipid bilayer) | NA | Staphylococcus aureus FDA209P, Staphylococcus smith, Micrococcus luteus FDA16, Micrococcus luteus IF03333, Micrococcus luteus PC11001, Bacillus subtilis NRRI B-558, Bacillus subtilis PC1219, Corynebacterium bouis 1810, Corynebacterium michiganense, Xantbmonas oryzae, Pseudomonas lachrymans, Escherichia coli NIHJ, Shigella sonnei JS11746, Proteus vulgaris OX19 | 1988 | 3182836 |
| antitb_1971 | Sapecin | ATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKAVCVCRN | Free | Free | None | Linear | 40 | L | Cationic | Natural | NIH-Sape-4, an Embryonic Cell Line of Sarcophaga peregrina | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | 78 μg/ml | In vitro | None | None | NA | NA | None | NA | NA | cell wall (lipid bilayer) | NA | Staphylococcus aureus FDA209P, Staphylococcus smith, Micrococcus luteus FDA16, Micrococcus luteus IF03333, Micrococcus luteus PC11001, Bacillus subtilis NRRI B-558, Bacillus subtilis PC1219, Corynebacterium bouis 1810, Corynebacterium michiganense, Xantbmonas oryzae, Pseudomonas lachrymans, Escherichia coli NIHJ, Shigella sonnei JS11746, Proteus vulgaris OX19 | 1988 | 3182836 |
| antitb_1980 | Granulysin(1-35) | GRDYRTSLTIVQKLKKMVDKPTQRSVSNAATRVSR | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 35 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 25-40% Killing -25µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1981 | Granulysin(1-35) | GRDYRTSLTIVQKLKKMVDKPTQRSVSNAATRVSR | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 35 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 45-60% Killing -100 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1982 | Granulysin(36-70) | TGRSRWRDVSRNFMRRYQSRVIQGLVAGETAQQIS | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 35 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 25-40% Killing -25µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |
| antitb_1983 | Granulysin(36-70) | TGRSRWRDVSRNFMRRYQSRVIQGLVAGETAQQIS | Free | Free | butanedione (BAD) or citraconic anhydride(CAH) | Linear | 35 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 45-60% Killing -100 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | cell wall | NA |  Escherichia coli | 2000 | 11120840 |