Primary information |
---|
ID | antitb_1980 |
Peptide Name | Granulysin(1-35) |
Sequence | GRDYRTSLTIVQKLKKMVDKPTQRSVSNAATRVSR |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | butanedione (BAD) or citraconic anhydride(CAH) |
Linear/ Cyclic | Linear |
Length | 35 |
Chirality | L |
Nature | Cationic |
Source | Synthetic |
Origin | NA |
Species | Mycobacterium tuberculosis |
Strain | Mycobacterium tuberculosis |
Inhibition Concentartion | 25-40% Killing -25µM |
In vitro/In vivo | In vitro |
Cell Line | NA |
Inhibition Concentartion | NA |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Response | NA |
Mechanism of Action | NA |
Target | cell wall |
Combination Therapy | NA |
Other Activities | Â Escherichia coli |
Pubmed ID | 11120840 |
Year of Publication | 2000 |
3-D Structure | NA |