Welcome to Peptide Card of AntiTbPdb
| This page displays user query in tabular form. |
TGRSRWRDVSRNFMRRYQSRVIQGLVAGETAQQIS details |
| Primary information | |
|---|---|
| ID | antitb_1982, |
| Name | 11120840 |
| N-Terminal modification | Granulysin(36-70) |
| C-Terminal Modification | TGRSRWRDVSRNFMRRYQSRVIQGLVAGETAQQIS |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | butanedione (BAD) or citraconic anhydride(CAH) |
| Chirality | Linear |
| Nature | 35 |
| Source | L |
| Origin | Cationic |
| Species | Synthetic |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis |
| Cell Line | 25-40% Killing -25µM |
| Inhibition Concentration | In vitro |
| Sequence | 2000 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other activities | cell wall |
| PMID | NA |
| Year of Publication | Â Escherichia coli |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1983, |
| Name | 11120840 |
| N-Terminal modification | Granulysin(36-70) |
| C-Terminal Modification | TGRSRWRDVSRNFMRRYQSRVIQGLVAGETAQQIS |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | butanedione (BAD) or citraconic anhydride(CAH) |
| Chirality | Linear |
| Nature | 35 |
| Source | L |
| Origin | Cationic |
| Species | Synthetic |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis |
| Cell Line | 45-60% Killing -100 µM |
| Inhibition Concentration | In vitro |
| Sequence | 2000 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other activities | cell wall |
| PMID | NA |
| Year of Publication | Â Escherichia coli |
| Tertiary Structure (Technique) | Not Predicted), |