| Primary information |
|---|
| ID | antitb_1983 |
| Peptide Name | Granulysin(36-70) |
| Sequence | TGRSRWRDVSRNFMRRYQSRVIQGLVAGETAQQIS |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | butanedione (BAD) or citraconic anhydride(CAH) |
| Linear/ Cyclic | Linear |
| Length | 35 |
| Chirality | L |
| Nature | Cationic |
| Source | Synthetic |
| Origin | NA |
| Species | Mycobacterium tuberculosis |
| Strain | Mycobacterium tuberculosis |
| Inhibition Concentartion | 45-60% Killing -100 µM |
| In vitro/In vivo | In vitro |
| Cell Line | NA |
| Inhibition Concentartion | NA |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Response | NA |
| Mechanism of Action | NA |
| Target | cell wall |
| Combination Therapy | NA |
| Other Activities | Â Escherichia coli |
| Pubmed ID | 11120840 |
| Year of Publication | 2000 |
| 3-D Structure | NA |