PRRID_0709 | Non-Structural Proetein 3 (NS3) Click for more detail | Hepatitis C Virus (virus) | AGARLVVLATATPPGSVTVPHPNIQEVALSNTGEIPFYGKAIPIEAIKGGRHLIFCHSKKKCDELAAKLSSLGLNAVAYYRGLD | 84 | Protein | Natural | It binds to the SREC-1 and activates the downstream cascade | Scavenger receptor A-1 (SR A-1) | Scavenger receptor (SR) | Chinese Hamster | Ovary cells | NA | NA | NA | NA | It has a role in NS3 uptake and cross-presentation. | ELISA | 20338659 | 2010 | NA |