Detailed description page of PRRDB2.0
This page displays user query in tabular form. |
PRRID_0709 details |
Primary information | |
---|---|
PRRID | PRRID_0709 |
Ligand Name | Non-Structural Proetein 3 (NS3) |
Source | Hepatitis C Virus (virus) |
Sequence of ligand | AGARLVVLATATPPGSVTVPHPNIQEVALSNTGEIPFYGKAIPIEAIKGGRHLIFCHSKKKCDELAAKLSSLGLNAVAYYRGLD |
Length | 84 |
Type | Protein |
Occurence | Natural |
Role of Ligand | It binds to the SREC-1 and activates the downstream cascade |
Name of receptor | Scavenger receptor A-1 (SR A-1) |
Type of receptor | Scavenger receptor (SR) |
Source | Chinese Hamster |
Localization | Ovary cells |
Domain | NA |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | It has a role in NS3 uptake and cross-presentation. |
Assay used | ELISA |
PMID | 20338659 |
Year of Publication | 2010 |
Pubchem assay | NA |
Primary information | |
---|---|
PRRID | PRRID_0709 |
Ligand Name | Non-Structural Proetein 3 (NS3) |
Source | Hepatitis C Virus (virus) |
Sequence of ligand | AGARLVVLATATPPGSVTVPHPNIQEVALSNTGEIPFYGKAIPIEAIKGGRHLIFCHSKKKCDELAAKLSSLGLNAVAYYRGLD |
Length | 84 |
Type | Protein |
Occurence | Natural |
Role of Ligand | It binds to the SREC-1 and activates the downstream cascade |
Name of receptor | Scavenger receptor A-1 (SR A-1) |
Type of receptor | Scavenger receptor (SR) |
Source | Chinese Hamster |
Localization | Ovary cells |
Domain | NA |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | It has a role in NS3 uptake and cross-presentation. |
Assay used | ELISA |
PMID | 20338659 |
Year of Publication | 2010 |
Pubchem assay | NA |