| Primary information |
|---|
| PRRID | PRRID_0708 |
| Ligand Name | Non-Structural Proetein 3 (NS3) |
| Source | Hepatitis C Virus (virus) |
| Sequence of ligand | AGARLVVLATATPPGSVTVPHPNIQEVALSNTGEIPFYGKAIPIEAIKGGRHLIFCHSKKKCDELAAKLSSLGLNAVAYYRGLD |
| Length | 84 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | It binds to the SRA-1 and activates the downstream cascade |
| Name of receptor | Scavenger receptor A-1 (SR A-1) |
| Type of receptor | Scavenger receptor (SR) |
| Source | Chinese Hamster |
| Localization | Ovary cells |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | It has a role in NS3 uptake and cross-presentation. |
| Assay used | ELISA |
| PMID | 20338659 |
| Year of Publication | 2010 |
| Pubchem assay | NA |
| Primary information |
|---|
| PRRID | PRRID_0708 |
| Ligand Name | Non-Structural Proetein 3 (NS3) |
| Source | Hepatitis C Virus (virus) |
| Sequence of ligand | AGARLVVLATATPPGSVTVPHPNIQEVALSNTGEIPFYGKAIPIEAIKGGRHLIFCHSKKKCDELAAKLSSLGLNAVAYYRGLD |
| Length | 84 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | It binds to the SRA-1 and activates the downstream cascade |
| Name of receptor | Scavenger receptor A-1 (SR A-1) |
| Type of receptor | Scavenger receptor (SR) |
| Source | Chinese Hamster |
| Localization | Ovary cells |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | It has a role in NS3 uptake and cross-presentation. |
| Assay used | ELISA |
| PMID | 20338659 |
| Year of Publication | 2010 |
| Pubchem assay | NA |