| 1036 | Cyclosporin A | cyclo[Abu-Sar-N(Me)Leu-Val-N(Me)Leu-Ala-D-Ala-N(Me)Leu-N(Me)Leu-N(Me)Val-N(Me)Bmt(E)] | 11 | Mix | None | None | Bmt = butenyl-methyl-threonine, Abu = L-alpha-aminobutyric acid, Sar = sarcosine, N(Me) = Amino acid is N-methylated | Cyclic | Natural | From fungus Trichoderma polysporum | Inhibit IL-2 production by activated CD4+ T-cells | Inhibiting the calcineurin pathway | Both | Peripheral blood mononuclear cells (PBMCs) | 61.8 nM for CD4+ T cell activation of IL-2 production | C57/B6 mice | MIC assay, Immunosuppression and toxicity test | NA | NA | 18599825 | 2008 |
| 1037 | Colutellin A | VISIIPV | 7 | L | None | None | None | Cyclic | Natural | Endophytic fungus Colletotrichum dematium | Inhibit IL-2 production by activated CD4+ T-cells | Inhibiting the calcineurin pathway | Both | Peripheral blood mononuclear cells (PBMCs) | 167.3±0.38 nM for CD4+ T cell activation of IL-2 production | C57/B6 mice | MIC assay, Immunosuppression and toxicity test | MIC of 3.6 mg/ml (48 h) against Botrytis cinerea and Sclerotinia sclerotiorum. | NA | 18599825 | 2008 |
| 1042 | ISP region (Mutant D105) | EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS | 35 | L | None | None | None | Linear | Protein Derived | Within the transmembrane (TM) protein of Mason-Pfizer monkey virus | T-cell and B-cell | Immunosuppressive effect on both T-cell and B-cell mitogenic response | In vitro | HeLa, COS-1, CV-1and BHK cells | NA | NA | NA | NA | NA | 1316462 | 1992 |
| 1043 | ISP region (Mutant D33) | LQNRRGLDLLT | 11 | L | None | None | None | Linear | Protein Derived | Within the transmembrane (TM) protein of Mason-Pfizer monkey virus | T-cell and B-cell | Immunosuppressive effect on both T-cell and B-cell mitogenic response | In vitro | HeLa, COS-1, CV-1and BHK cells | NA | NA | NA | NA | NA | 1316462 | 1992 |
| 1143 | HLA B-2702 (2702.75-84) | RENLRIALRY | 10 | L | None | None | None | Linear | Natural | NA | T-cell | Inhibits the differentiation of cytotoxic T cells and also decrease natural killer (NK) cell-mediated cytotoxicity | In vivo | NA | NA | Eight- to 12-week-old male Lewis.lW (RTI.u) and Lewis.lA (RTI.')rats | Graft transplation assay | NA | NA | 10666482 | 2000 |
| 1144 | B-0701 (07.75-84) | RESLRNLRGY | 10 | L | None | None | None | Linear | Natural | NA | T-cell | Inhibits the differentiation of cytotoxic T cells and also decrease natural killer (NK) cell-mediated cytotoxicity | In vivo | NA | 200 micromolar | Eight- to 12-week-old male Lewis.lW (RTI.u) and Lewis.lA (RTI.')rats | Graft transplation assay | NA | NA | 10666482 | 2000 |
| 1206 | NA | AALKEECCFLKEEC | 14 | L | None | None | None | Linear | Synthetic | Retro virus | T-cells | Inhibiting T-cell proliferation | In vitro | Spleen cells | NA | Murine (C57BL/6 strain) | Inhibition of Concanavalin A-induced T-cell Proliferation of murine | NA | NA | WO 1988005783 A1 | 1988 |
| 1207 | NA | QEGGLCAALKEEC | 13 | L | None | None | None | Linear | Synthetic | Retro virus | T-cells | Inhibiting T-cell proliferation | In vitro | Spleen cells | NA | Murine (C57BL/6 strain) | Inhibition of Concanavalin A-induced T-cell Proliferation of murine | NA | NA | WO 1988005783 A1 | 1988 |
| 1208 | NA | QREKRAVGIGALFLGFLG | 18 | L | None | None | None | Linear | Synthetic | Retro virus | T-cells | Inhibiting T-cell proliferation | In vitro | Spleen cells | NA | Murine (C57BL/6 strain) | Inhibition of Concanavalin A-induced T-cell Proliferation of murine | NA | NA | WO 1988005783 A1 | 1988 |
| 1209 | NA | QLTVWGIKQLQARIL | 15 | L | None | None | None | Linear | Synthetic | Retro virus | T-cells | Inhibiting T-cell proliferation | In vitro | Spleen cells | NA | Murine (C57BL/6 strain) | Inhibition of Concanavalin A-induced T-cell Proliferation of murine | NA | NA | WO 1988005783 A1 | 1988 |
| 1210 | NA | AQNRRGLDLLFWEQGGLC | 18 | L | None | None | None | Linear | Synthetic | Retro virus | T-cells | Inhibiting T-cell proliferation | In vitro | Spleen cells | NA | Murine (C57BL/6 strain) | Inhibition of Concanavalin A-induced T-cell Proliferation of murine | NA | NA | WO 1988005783 A1 | 1988 |
| 1223 | sequence no 4 | HFKRPLPPLPSL | 12 | L | None | None | None | Linear | Synthetic | NA | T-cell, Hematopoietic cell | Human T-cell tyrosine kinase (Lck) inhibitor, Hematopoietic cell kinase (Hck) inhibitor | In vitro | NA | NA | NA | Lck-SH3 binding assay, NMR Spectroscopy, protein-protein interactions assay by PepSpot membranes | NA | NA | EP 1983050 A1 | 2008 |
| 1224 | SEQ ID NO:60 | LVCYYTSWS | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1225 | SEQ ID NO:61 | FLCTHIIYS | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1226 | SEQ ID NO:62 | IIYSFANIS | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1227 | SEQ ID NO:63 | LKTLLSVGG | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1228 | SEQ ID NO:64 | FIKSVPPFL | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1229 | SEQ ID NO:65 | FDGLDLAWL | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1230 | SEQ ID NO:66 | LYPGRRDKQ | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1231 | SEQ ID NO:67 | YDIAKISQH | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1232 | SEQ ID NO:68 | LDFISIMTY | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1233 | SEQ ID NO:69 | FISIMTYDF | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1234 | SEQ ID NO:70 | FRGQEDASP | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1235 | SEQ ID NO:71 | YAVGYMLRL | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1236 | SEQ ID NO:72 | MLRLGAPAS | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1237 | SEQ ID NO:73 | LAYYEICDF | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1238 | SEQ ID NO:74 | LRGATVHRT | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1239 | SEQ ID NO:75 | YLKDRQLAG | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1240 | SEQ ID NO:76 | LAGAMVWAL | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1241 | SEQ ID NO:77 | VWALDLDDF | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1242 | SEQ ID NO:78 | LDLDDFQGS | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1243 | SEQ ID NO:l | YKLVCYYTSWSQYREG | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1244 | SEQ ID NO:2 | YTSWSQYREGDGSCFP | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1245 | SEQ ID NO:5 | LDRFLCTHIIYSFANI | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1246 | SEQ ID NO:6 | THIIYSFANISNDHID | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1247 | SEQ ID NO:12 | PNLKTLLSVGGWNFGS | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1248 | SEQ ID NO:16 | NTQSRRTFIKSVPPFL | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1249 | SEQ ID NO:17 | TFIKSVPPFLRTHGFD | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1250 | SEQ ID NO:18 | PPFLRTHGFDGLDLAW | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1251 | SEQ ID NO:19 | HGFDGLDLAWLYPGRR | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1252 | SEQ ID NO:20 | DLAWLYPGRRDKQHFT | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1253 | SEQ ID NO:28 | IDSSYDIAKISQHLD | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1254 | SEQ ID NO:29 | DIAKISQHLDFISIMT | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1255 | SEQ ID NO:30 | QHLDFISIMTYDFHGA | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1256 | SEQ ID NO:34 | SPLFRGQEDASPDRFS | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1257 | SEQ ID NO:37 | DYAVGYMLRLGAPASK | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1258 | SEQ ID NO:38 | MLRLGAPASKLVMGIP | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1259 | SEQ ID NO:39 | PASKLVMGIPTFGRSF | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1260 | SEQ ID NO:46 | GTLAYYEICDFLRGAT | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1261 | SEQ ID NO:47 | EICDFLRGATVHRTLG | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
