1417 | SEQ ID44 | RSCIDTIPKSRCTAFQCKHAMKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1418 | SEQ ID45 | RSCIDTIPKSRCTAFQCKHSAKYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1419 | SEQ ID46 | RSCIDTIPKSRCTAFQCKHSMAYRLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1420 | SEQ ID47 | RSCIDTIPKSRCTAFQCKHSMKARLSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1421 | SEQ ID48 | RSCIDTIPKSRCTAFQCKHSMKYALSFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1422 | SEQ ID49 | RSCIDTIPKSRCTAFQCKHSMKYRASFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1423 | SEQ ID50 | RSCIDTIPKSRCTAFQCKHSMKYRLAFCRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1424 | SEQ ID51 | RSCIDTIPKSRCTAFQCKHSMKYRLSACRKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1425 | SEQ ID52 | RSCIDTIPKSRCTAFQCKHSMKYRLSFCAKTCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1426 | SEQ ID53 | RSCIDTIPKSRCTAPQCKHSMKYRLSFCRATCGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1427 | SEQ ID54 | RSCIDTIPKSRCTAPQCKHSMKYRLSFCRKACGTC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1428 | SEQ ID55 | RSCIDTIPKSRCTAPQCKHSMKYRLSFCRKTCGAC | 35 | L | None | None | None | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1429 | SEQ ID56 | RSCIDTIPKSRCTAFQCKHSMXYRLSFCRKTCGTC | 35 | L | None | None | X = diaminopropanoic acid | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1430 | SEQ ID57 | RSCIDTIPKSRCTAFQCKHSMKXRLSFCRKTCGTC | 35 | L | None | None | X = benzoylphenylalanine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1431 | SEQ ID58 | XSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | X = N-acetyl-arginine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1432 | SEQ ID59 | RSCIDTIPKSRCTAXQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | X = azidophenylalanine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1433 | SEQ ID60 | RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Cyclic (C3-C35, C12 | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1434 | SEQ ID61 | RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | None | Cyclic (C3-C35) | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1435 | Nef2-19 | GGKWSKSSVIGWPAVRERMRR | 21 | L | None | None | None | Linear | Natural | NL4.3 strain of HIV-1 | T -cells | Downregulates CD4 and IL-2 | In vitro | CD4+ T-cell lines, PBMC, MT-2 cells, Jurkat cells | NA | None | Hummoral Immune Response assay | NA | NA | US 6197583 B1 | 2001 |
1436 | iDD | iGlu-w | 2 | D | None | None | iGlu = iso glutamic acid | Linear | Synthetic | Not mentioned | NA | Inhibits cell proliferation | In vivo | None | NA | Mice spleen cells | Thymidine suicide test | 0.02μg/ml | NA | US 6410515 B1 | 2002 |
1437 | None | ew | 2 | D | None | None | None | Linear | Synthetic | Not mentioned | NA | Inhibits cell proliferation | In vivo | None | NA | Mice spleen cells | Thymidine suicide test | 0.02μg/ml | NA | US 6410515 B1 | 2002 |
1464 | SEQ ID4 | QKRAAYDQYGHAAFE | 15 | L | None | None | None | Linear | Synthetic | dnaJP1 | NA | inducing T-cell response | In vitro | Peripheral blood lymphocytes | NA | None | NA | NA | NA | US 6946132 B2 | 2005 |
1465 | SEQ ID5 | DERAAYDQYGHAAFE | 15 | L | None | None | None | Linear | Synthetic | dnaJ | NA | inducing T-cell response | In vitro | Peripheral blood lymphocytes | NA | None | NA | NA | NA | US 6946132 B2 | 2005 |
1466 | SEQ ID6 | VLTDSQKRAAYDQYG | 15 | L | None | None | None | Linear | Synthetic | dnaJP2 | NA | inducing T-cell response | In vitro | Peripheral blood lymphocytes | NA | None | NA | NA | NA | US 6946132 B2 | 2005 |
1467 | SEQ ID7 | QKRAAVDTYCRHNYG | 15 | L | None | None | None | Linear | Protein Derived | human S1 HLA peptide | NA | inducing T-cell response | In vitro | Peripheral blood lymphocytes | NA | None | NA | NA | NA | US 6946132 B2 | 2005 |
1468 | SEQ ID10 | rlllrlllGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1469 | SEQ ID11 | rvllrlllGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1470 | SEQ ID12 | rillrlllGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1471 | SEQ ID13 | rlvrlllGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1472 | SEQ ID14 | rlilrlllGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1473 | SEQ ID15 | rllvrlllGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1474 | SEQ ID16 | rllirlllGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1475 | SEQ ID17 | rlllrvllGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1476 | SEQ ID18 | rlllrillGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1477 | SEQ ID19 | rlllrlvlGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1478 | SEQ ID20 | rlllrlilGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1479 | SEQ ID21 | rlllrllvGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1480 | SEQ ID22 | rlllrlliGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1481 | SEQ ID23 | rwllrlllGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1482 | SEQ ID24 | rlwlrlllGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1483 | SEQ ID25 | rllwrlllGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1484 | SEQ ID26 | rlllrwllGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1485 | SEQ ID27 | rlllrlwlGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1486 | SEQ ID28 | rlllrllwGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1487 | SEQ ID29 | ryllrlllGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1488 | SEQ ID30 | rlylrlllGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1489 | SEQ ID31 | rllyrlllGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1490 | SEQ ID32 | rlllryllGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1491 | SEQ ID33 | rlllrlylGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |
1492 | SEQ ID34 | rlllrllyGy | 10 | Mix | None | None | None | Linear | Protein Derived | (HLA-B) α1-domain | Gut Associated Lymphoid Tissue (GALT) | Increased CD4+ and CD8+ T-cells | In vivo | None | NA | Rhesus macaques | NA | NA | NA | US 7094413 B2 | 2006 |