A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10017
Swiss-prot Accession number	P68273 (Sequence in FASTA format)
Description	Glucagon.
Source organism	Camelus dromedarius (Dromedary) (Arabian camel)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Tylopoda;Camelidae; Camelus.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis
Protein Length	29 Amino acids
Molecular weight	3483
References	1  PubMed abstract 4421675
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10057
Swiss-prot Accession number	Q27IM2 (Sequence in FASTA format)
Description	Parathyroid hormone precursor (Parathyrin) (PTH).
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the parathyroid hormone family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion
Protein Length	115 Amino acids
Molecular weight	13062
References	1   Rourke K.M., Kohn C.W., Rosol T.J., Toribio R.E.; Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases. 2   Shiue Y.-L., Caetano A.R., Lyons L.A., O'Brien S.J., Laughlin T.F.,Murray J.D., Bowling A.T.; Submitted (MAR-1999) to the EMBL/GenBank/DDBJ databases.
Domain Name	Parathyroid
Hormone Name	Parathyroid hormone (Parathyrin) (PTH)
Mature Hormone Sequence	SVSEIQLMHNLGKHLNSVERVEWLRKKLQDVHNFIALGAPIFHRDGGSQRPRKKEDNVLIESHQKSLGEADKADVDVLSKTKSQ
Position of mature hormone in Pre-Hormone protein	84 Residues from position (32-115)
Receptor	N/A
Gene ID	100034104
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10058
Swiss-prot Accession number	Q4FCM6 (Sequence in FASTA format)
Description	Bursicon precursor (Bursicon subunit alpha) (Cuticle-tanning hormone).
Source organism	Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Sphingoidea;Sphingidae; Sphinginae; Manduca.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Contains 1 CTCK (C-terminal cystine knot-like) domain.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading
Protein Length	156 Amino acids
Molecular weight	17659
References	1   Dewey E.M., Honegger H.-W.; "Identification of the Manduca sexta burs cDNA using RACE PCR."; Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	N/A
Hormone Name	Bursicon
Mature Hormone Sequence	QEVQLPPGQECQMTPVIHILKHRGCKPKAIPSFACIGKCTSYVQVSGSKIWQMERTCNCCQEAGEREATVVLYCPDAKNEERRFRKVSTKAPLECMCRPCGSIEESAIIPQEVAGYAEEGPLYNHFRKSF
Position of mature hormone in Pre-Hormone protein	130 Residues from position (27-156)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10059
Swiss-prot Accession number	Q566B1 (Sequence in FASTA format)
Description	Bursicon precursor (Bursicon subunit alpha) (Cuticle-tanning hormone).
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Contains 1 CTCK (C-terminal cystine knot-like) domain.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading
Protein Length	160 Amino acids
Molecular weight	17901
References	1  PubMed abstract 15141943 2  PubMed abstract 15811337
Domain Name	N/A
Hormone Name	Bursicon
Mature Hormone Sequence	FPVTGHEVQLPPGTKFFCQECQMTAVIHVLKHRGCKPKAIPSFACIGKCTSYVQVSGSKIWQMERTCNCCQESGEREATVVLFCPDAQNEEKRFRKVSTKAPLQCMCRPCGSIEESSIIPQEVAGYSEEGPLYNHFRKSL
Position of mature hormone in Pre-Hormone protein	140 Residues from position (21-160)
Receptor	N/A
Gene ID	100049169
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10115
Swiss-prot Accession number	Q9GKY5 (Sequence in FASTA format)
Description	Appetite-regulating hormone precursor (Growth hormone secretagogue)(Growth hormone-releasing peptide) (Motilin-related peptide)[Contains: Ghrelin; Obestatin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the motilin family.
Tissue Specificity	N/A
Post translational modification	O-n-octanoylation is essential for ghrelin activity (By similarity). Amidation of Leu-99 is essential for obestatin activity (By similarity).
Function	Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation
Protein Length	118 Amino acids
Molecular weight	12786
References	1   Kojima M.; Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases. 2   Rousselle J., Lacroix D., Dubreuil P.; Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases. 3   Ying M., Yang Z.; Submitted (JAN-2006) to the EMBL/GenBank/DDBJ databases.
Domain Name	Motilin_assoc  Motilin_ghrelin
Hormone Name	Ghrelin
Mature Hormone Sequence	GSSFLSPEHQKVQQRKESKKPAAKLKPR
Position of mature hormone in Pre-Hormone protein	28 Residues from position (25-52)
Receptor	P34999    Detail in HMRbase
Gene ID	396728
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 6

HMRbase accession number	10135
Swiss-prot Accession number	P91963 (Sequence in FASTA format)
Description	Pigment-dispersing hormone type 1 precursor [Contains: PDH precursor-related peptide (PPRD); Pigment-dispersing hormone (PDH)].
Source organism	Penaeus vannamei (Penoeid shrimp) (European white shrimp)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Litopenaeus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the arthropod PDH family.
Tissue Specificity	Eyestalk
Post translational modification	N/A
Function	The pigment-dispersing hormone causes the migration of the distal retinal pigment into the proximal end of the pigment chromatophore cells and thus decreases the amount of light entering the retinulas. May also function as a neurotransmitter and/or neuromodulator
Protein Length	79 Amino acids
Molecular weight	8561
References	1  PubMed abstract 8630031
Domain Name	Pigment_DH
Hormone Name	Pigment-dispersing hormone
Mature Hormone Sequence	NSELINSLLGIPKVMNDA
Position of mature hormone in Pre-Hormone protein	18 Residues from position (59-76)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10137
Swiss-prot Accession number	P91964 (Sequence in FASTA format)
Description	Pigment-dispersing hormone type 2 precursor [Contains: PDH precursor-related peptide (PPRD); Pigment-dispersing hormone (PDH)].
Source organism	Penaeus vannamei (Penoeid shrimp) (European white shrimp)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Litopenaeus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the arthropod PDH family.
Tissue Specificity	Eyestalk
Post translational modification	N/A
Function	The pigment-dispersing hormone causes the migration of the distal retinal pigment into the proximal end of the pigment chromatophore cells and thus decreases the amount of light entering the retinulas. May also function as a neurotransmitter and/or neuromodulator
Protein Length	80 Amino acids
Molecular weight	8670
References	1  PubMed abstract 8630031
Domain Name	Pigment_DH
Hormone Name	Pigment-dispersing hormone
Mature Hormone Sequence	NSELINSLLGIPKVMNDA
Position of mature hormone in Pre-Hormone protein	18 Residues from position (60-77)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	10144
Swiss-prot Accession number	Q659Q8 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Balaenoptera physalus (Finback whale) (Common rorqual)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues
Protein Length	216 Amino acids
Molecular weight	24479
References	1   Wallis O.C., Maniou Z., Wallis M.; "Cloning and characterization of the gene encoding pituitary growthhormone in the finback whale (Balaenoptera physalus)."; Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases.
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
Position of mature hormone in Pre-Hormone protein	190 Residues from position (27-216)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	10201
Swiss-prot Accession number	Q6SV86 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Bubalus bubalis (Domestic water buffalo)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bubalus.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14593
References	1   Wang A., Shi D., Li N.; "Sequence analysis of the water buffalo follicle stimulating hormone-beta subunit gene."; Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases. 2   Yadav S.P., Goswami S.L., De S., Datta T.K., Yadav P., Raghvan S.,Singh R.; Submitted (MAY-2006) to the EMBL/GenBank/DDBJ databases. 3   Wang A., Shi D., Li N.; "Sequence analysis of the water buffalo follicle stimulating hormone-beta subunit gene."; Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases. 4   Yadav S.P., Goswami S.L., De S., Datta T.K., Yadav P., Raghvan S.,Singh R.; Submitted (MAY-2006) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELTNITITVEKEECGFCISINTTWCAGYCYTRDLVYRDPARPNIQKTCTYKELVYETVKVPGCAHHADSLYTYPVATECQCGKCDGDSTDCTVRGLGPSYCSFSESRE
Position of mature hormone in Pre-Hormone protein	109 Residues from position (21-129)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	10202
Swiss-prot Accession number	Q8HY84 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Cervus nippon (Sika deer)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Cervidae; Cervinae; Cervus.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14551
References	1   Guan H.-B., Li Q.-Z., Zhang L.; "Nucleotide sequence of cloned cDNA for beta subunit of Cervus nipponfollicle stimulating hormone."; Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases. 2   Guan H.-B., Li Q.-Z., Zhang L.; "Nucleotide sequence of cloned cDNA for beta subunit of Cervus nipponfollicle stimulating hormone."; Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	RSCELTNITITVEKEECSFCISINTTWCAGYCYTRDLVYRDPARPNIQKTCTFKELVYETVRVPGCAHRADSLHTYPVATACHCGKCDSGSTDCTVRGLGPSYCSFSDIRE
Position of mature hormone in Pre-Hormone protein	111 Residues from position (19-129)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	10288
Swiss-prot Accession number	Q5CZK2 (Sequence in FASTA format)
Description	Relaxin-3 precursor (Prorelaxin H3) [Contains: Relaxin-3 B chain;Relaxin-3 A chain].
Source organism	Pan troglodytes (Chimpanzee)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May play a role in neuropeptide signaling processes. Ligand for LGR7, relaxin-3 receptor-1 (GPCR135) and relaxin-3 receptor-2 (GPCR142)
Protein Length	142 Amino acids
Molecular weight	15348
References	1  PubMed abstract 16136131 2  PubMed abstract 15707501
Domain Name	Insulin
Hormone Name	Relaxin-3 B chain
Mature Hormone Sequence	RAAPYGVRLCGREFIRAVIFTCGGSRW
Position of mature hormone in Pre-Hormone protein	27 Residues from position (26-52)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	10289
Swiss-prot Accession number	Q5CZK2 (Sequence in FASTA format)
Description	Relaxin-3 precursor (Prorelaxin H3) [Contains: Relaxin-3 B chain;Relaxin-3 A chain].
Source organism	Pan troglodytes (Chimpanzee)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May play a role in neuropeptide signaling processes. Ligand for LGR7, relaxin-3 receptor-1 (GPCR135) and relaxin-3 receptor-2 (GPCR142)
Protein Length	142 Amino acids
Molecular weight	15348
References	1  PubMed abstract 16136131 2  PubMed abstract 15707501
Domain Name	Insulin
Hormone Name	Relaxin-3 A chain
Mature Hormone Sequence	DVLAGLSSSCCKWGCSKSEISSLC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (119-142)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	10292
Swiss-prot Accession number	Q9MYK8 (Sequence in FASTA format)
Description	Prorelaxin precursor (RXN) [Contains: Relaxin B chain; Relaxin Achain].
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	Expressed by the placenta. Exclusively detected in cells located in the lamellar placental labyrinth and absent from other placental and nonplacental uterine parts
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	180 Amino acids
Molecular weight	20360
References	1  PubMed abstract 9915995
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	QEEVLKACGREFVRLQIRICGSLSWG
Position of mature hormone in Pre-Hormone protein	26 Residues from position (26-51)
Receptor	N/A
Gene ID	493883
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 14

HMRbase accession number	10293
Swiss-prot Accession number	Q9MYK8 (Sequence in FASTA format)
Description	Prorelaxin precursor (RXN) [Contains: Relaxin B chain; Relaxin Achain].
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	Expressed by the placenta. Exclusively detected in cells located in the lamellar placental labyrinth and absent from other placental and nonplacental uterine parts
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	180 Amino acids
Molecular weight	20360
References	1  PubMed abstract 9915995
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	SDYIRYSDRCCNVGCTRKELADLC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (157-180)
Receptor	N/A
Gene ID	493883
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 15

HMRbase accession number	10326
Swiss-prot Accession number	Q5XXR2 (Sequence in FASTA format)
Description	Pro-MCH precursor [Contains: Neuropeptide-glycine-glutamic acid (NGE)(Neuropeptide G-E); Neuropeptide-glutamic acid-isoleucine (NEI)(Neuropeptide E-I); Melanin-concentrating hormone (MCH)].
Source organism	Canis familiaris (Dog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the melanin-concentrating hormone family.
Tissue Specificity	N/A
Post translational modification	Pro-MCH is processed differentially in the brain and in peripheral organs producing two neuropeptides; NEI and MCH. A third peptide, NGE, may also be produced. Preferential processing in neurons by prohormone convertase 2 (PC2) generates NEI. MCH is generated in neurons of the lateral hypothalmic area by several prohormone convertases including PC1/3, PC2 and PC5/6 (By similarity). MCH is a cyclic peptide (By similarity).
Function	MCH may act as a neurotransmitter or neuromodulator in a broad array of neuronal functions directed toward the regulation of goal-directed behavior, such as food intake, and general arousal
Protein Length	165 Amino acids
Molecular weight	18644
References	1   Steflik J., Waters S.M.; "Canine pro-melanin-concentrating hormone."; Submitted (AUG-2004) to the EMBL/GenBank/DDBJ databases.
Domain Name	Pro-MCH
Hormone Name	Melanin-concentrating hormone
Mature Hormone Sequence	DFDMLRCMLGRVYRPCWQV
Position of mature hormone in Pre-Hormone protein	19 Residues from position (147-165)
Receptor	Q8MIP5   Detail in HMRbase    Q8MIP6    Detail in HMRbase
Gene ID	449022
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 16

HMRbase accession number	10329
Swiss-prot Accession number	Q6EV79 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14644
References	1  PubMed abstract 10612425 2  PubMed abstract 10612425
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKEVVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFSEMKE
Position of mature hormone in Pre-Hormone protein	111 Residues from position (19-129)
Receptor	P32212    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 17

HMRbase accession number	10342
Swiss-prot Accession number	Q925Q4 (Sequence in FASTA format)
Description	Glycoprotein hormone alpha-2 precursor (Thyrostimulin subunit alpha).
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the thyroid. Binds and activates THSR, leads to increased cAMP production
Protein Length	130 Amino acids
Molecular weight	14199
References	1   Dasovich M., Ching A., Lok S., Sheppard P., Webster P.; "A novel cysteine knot protein expressed in pancreatic acinar cells."; Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases.
Domain Name	N/A
Hormone Name	Glycoprotein hormone alpha-2
Mature Hormone Sequence	LEAAVPIPGCHLHPFNVTVRSDRHGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISSLKKVRVWLHCVGNQRGELEIFTARACQCDMCRLSRY
Position of mature hormone in Pre-Hormone protein	108 Residues from position (23-130)
Receptor	P21463    Detail in HMRbase
Gene ID	171158
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 18

HMRbase accession number	10343
Swiss-prot Accession number	Q925Q5 (Sequence in FASTA format)
Description	Glycoprotein hormone alpha-2 precursor (Thyrostimulin subunit alpha).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the thyroid. Binds and activates THSR, leads to increased cAMP production
Protein Length	128 Amino acids
Molecular weight	14030
References	1   Ching A., Gilbert T., Sheppard P., Webster P., O'Hara P.J.; "A novel cysteine knot protein expressed in pancreatic acinar cells."; Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 15489334
Domain Name	N/A
Hormone Name	Glycoprotein hormone alpha-2
Mature Hormone Sequence	HSPETAIPGCHLHPFNVTVRSDRLGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSSSQCCTISSLRKVRVWLQCVGNQRGELEIFTARACQCDMCRFSRY
Position of mature hormone in Pre-Hormone protein	108 Residues from position (21-128)
Receptor	P47750    Detail in HMRbase
Gene ID	170458
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 19

HMRbase accession number	10347
Swiss-prot Accession number	Q9BDJ6 (Sequence in FASTA format)
Description	Appetite-regulating hormone precursor (Growth hormone secretagogue)(Growth hormone-releasing peptide) (Motilin-related peptide)[Contains: Ghrelin; Obestatin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the motilin family.
Tissue Specificity	N/A
Post translational modification	O-n-octanoylation is essential for ghrelin activity (By similarity). Amidation of Leu-97 is essential for obestatin activity (By similarity).
Function	Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation
Protein Length	116 Amino acids
Molecular weight	12793
References	1   Kita K., Harada K., Yokota H.; Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases. 2   Li C., Lobo S., Wang Z., Fu A., Meng Y., Murdoch B., Hansen C.,Moore S.; "A full length genomic sequence of the bovine ghrelin gene."; Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases. 3   Kojima M.; Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases.
Domain Name	Motilin_assoc  Motilin_ghrelin
Hormone Name	Ghrelin
Mature Hormone Sequence	GSSFLSPEHQKLQRKEAKKPSGRLKPR
Position of mature hormone in Pre-Hormone protein	27 Residues from position (24-50)
Receptor	Q9BDH9   Detail in HMRbase    Q9N1F8   Detail in HMRbase    Q9TUJ0   Detail in HMRbase    Q9TUJ1    Detail in HMRbase
Gene ID	281192
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 20

HMRbase accession number	10348
Swiss-prot Accession number	Q9BDJ6 (Sequence in FASTA format)
Description	Appetite-regulating hormone precursor (Growth hormone secretagogue)(Growth hormone-releasing peptide) (Motilin-related peptide)[Contains: Ghrelin; Obestatin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the motilin family.
Tissue Specificity	N/A
Post translational modification	O-n-octanoylation is essential for ghrelin activity (By similarity). Amidation of Leu-97 is essential for obestatin activity (By similarity).
Function	Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility
Protein Length	116 Amino acids
Molecular weight	12793
References	1   Kita K., Harada K., Yokota H.; Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases. 2   Li C., Lobo S., Wang Z., Fu A., Meng Y., Murdoch B., Hansen C.,Moore S.; "A full length genomic sequence of the bovine ghrelin gene."; Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases. 3   Kojima M.; Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases.
Domain Name	Motilin_assoc  Motilin_ghrelin
Hormone Name	Obestatin
Mature Hormone Sequence	FNAPFNIGIKLAGAQSLQHGQTL
Position of mature hormone in Pre-Hormone protein	23 Residues from position (75-97)
Receptor	Q9BDH9   Detail in HMRbase    Q9N1F8   Detail in HMRbase    Q9TUJ0   Detail in HMRbase    Q9TUJ1    Detail in HMRbase
Gene ID	281192
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 21

HMRbase accession number	10352
Swiss-prot Accession number	Q9GKY5 (Sequence in FASTA format)
Description	Appetite-regulating hormone precursor (Growth hormone secretagogue)(Growth hormone-releasing peptide) (Motilin-related peptide)[Contains: Ghrelin; Obestatin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the motilin family.
Tissue Specificity	N/A
Post translational modification	O-n-octanoylation is essential for ghrelin activity (By similarity). Amidation of Leu-99 is essential for obestatin activity (By similarity).
Function	Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility
Protein Length	118 Amino acids
Molecular weight	12786
References	1   Kojima M.; Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases. 2   Rousselle J., Lacroix D., Dubreuil P.; Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases. 3   Ying M., Yang Z.; Submitted (JAN-2006) to the EMBL/GenBank/DDBJ databases.
Domain Name	Motilin_assoc  Motilin_ghrelin
Hormone Name	Obestatin
Mature Hormone Sequence	FNAPCDVGIKLSGAQSDQHGQPL
Position of mature hormone in Pre-Hormone protein	23 Residues from position (77-99)
Receptor	P34999    Detail in HMRbase
Gene ID	396728
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 22

HMRbase accession number	10506
Swiss-prot Accession number	P79295 (Sequence in FASTA format)
Description	Muellerian-inhibiting factor precursor (MIS) (Anti-Muellerian hormone)(AMH) (Muellerian-inhibiting substance).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the TGF-beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin
Protein Length	575 Amino acids
Molecular weight	61505
References	1   Daneau I., Silversides D.W.; Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases.
Domain Name	N/A
Hormone Name	Muellerian-inhibiting factor
Mature Hormone Sequence	REEVSSTPALPREPRTGTEGLIFHWDWNWPPPGAWPPGGPQDPLCLVTLNGTPGNGSSPFLWVVGTLSSYEQAFLEAVRHARWGPQDLANFGLCPPSLRQAALPLLQQLQAWLGEPRGQRLVVLHLEEVSWEPTPLLKFQEPLPGEASPLELALLVLYPGPGPEVTVTGAGLPGAQSLCPTRDSGFLALAVDRPERAWRGSGLALTLRRRGNGASLSTAQLQALLFGADSRCFTRMTPALLLLPPQGPVPMPAHGRVDSMPFPQPRLSPEPEEPLPSTDPFLETLTRLVRALRGPPARIPPPSLALDPGALAGFPQGQVNLSDPAALERLLNSEEPLLLLLPPPTAVTAGVPAPLQGPVTEMWASSLARRVATEFQSAAAELRGFPGLPPTATLLLARLLALCPGDRGDPGGPLRAVLLLKALQGLRTEWRWRERSGPARAQRSAGTAVSNGPCALRELSVDLRAERSVLIPETYQANNCQGTCGWPQSDRNPRYGNHVVLLLKMQARGAALARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCR
Position of mature hormone in Pre-Hormone protein	552 Residues from position (24-575)
Receptor	N/A
Gene ID	397578
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 23

HMRbase accession number	10510
Swiss-prot Accession number	Q66Q82 (Sequence in FASTA format)
Description	Bursicon precursor (Bursicon subunit alpha) (Cuticle-tanning hormone).
Source organism	Anopheles gambiae (African malaria mosquito)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Culicidae;Anophelinae; Anopheles.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Contains 1 CTCK (C-terminal cystine knot-like) domain.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading
Protein Length	163 Amino acids
Molecular weight	18067
References	1   Robertson H.M., Honegger W.; "Anopheles gambiae bursicon gene is transspliced."; Submitted (AUG-2004) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 12364791
Domain Name	N/A
Hormone Name	Bursicon
Mature Hormone Sequence	QKDSEDGGSHYSSDDCQVTPVIHVLQYPGCVPKPIPSFACIGRCASYIQVSGSKIWQMERSCMCCQESGEREASVSLFCPKAKNGEKKFRKVSTKAPLECMCRPCTGIEDANVIPQELTSFADEGTLTGYFQKSHYKSIE
Position of mature hormone in Pre-Hormone protein	140 Residues from position (24-163)
Receptor	N/A
Gene ID	5667449
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 24

HMRbase accession number	10518
Swiss-prot Accession number	Q9VLK4 (Sequence in FASTA format)
Description	Diuretic hormone class-II precursor (Diuretic peptide) (DP) (DH(31)).
Source organism	Drosophila melanogaster (Fruit fly)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha;Ephydroidea; Drosophilidae; Drosophila.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the diuretic hormone class II family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Regulation of fluid secretion. Stimulates Malpighian tubules fluid secretion by activating the apical membrane V-ATPase via cyclic AMP of principal cells in the main secretory segment
Protein Length	116 Amino acids
Molecular weight	12622
References	1  PubMed abstract 10731132 2  PubMed abstract 12537572 3   Stapleton M., Carlson J.W., Chavez C., Frise E., George R.A.,Pacleb J.M., Park S., Wan K.H., Yu C., Rubin G.M., Celniker S.E.; Submitted (APR-2004) to the EMBL/GenBank/DDBJ databases. 4  PubMed abstract 11316500
Domain Name	N/A
Hormone Name	Diuretic hormone class-II
Mature Hormone Sequence	TVDFGLARGYSGTQEAKHRMGLAAANFAGGP
Position of mature hormone in Pre-Hormone protein	31 Residues from position (76-106)
Receptor	N/A
Gene ID	34181
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 25

HMRbase accession number	10613
Swiss-prot Accession number	A0MLS4 (Sequence in FASTA format)
Description	Appetite-regulating hormone precursor (Growth hormone secretagogue)(Growth hormone-releasing peptide) (Motilin-related peptide)[Contains: Ghrelin; Obestatin].
Source organism	Papio hamadryas (Hamadryas baboon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the motilin family.
Tissue Specificity	N/A
Post translational modification	O-n-octanoylation is essential for ghrelin activity (By similarity). Amidation of Leu-98 is essential for obestatin activity (By similarity).
Function	Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation
Protein Length	117 Amino acids
Molecular weight	12913
References	1   Voruganti V.S., Tejero M.E., Proffitt J.M., Cole S.A.,Freeland-Graves J.H., Comuzzie A.G.; "Quantitative genetic analysis and characterization of ghrelin inbaboons."; Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases.
Domain Name	Motilin_assoc  Motilin_ghrelin
Hormone Name	Ghrelin
Mature Hormone Sequence	GSSFLSPEHQRAQQRKESKKPPAKLQPR
Position of mature hormone in Pre-Hormone protein	28 Residues from position (24-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 26

HMRbase accession number	10614
Swiss-prot Accession number	A0MLS4 (Sequence in FASTA format)
Description	Appetite-regulating hormone precursor (Growth hormone secretagogue)(Growth hormone-releasing peptide) (Motilin-related peptide)[Contains: Ghrelin; Obestatin].
Source organism	Papio hamadryas (Hamadryas baboon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the motilin family.
Tissue Specificity	N/A
Post translational modification	O-n-octanoylation is essential for ghrelin activity (By similarity). Amidation of Leu-98 is essential for obestatin activity (By similarity).
Function	Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility
Protein Length	117 Amino acids
Molecular weight	12913
References	1   Voruganti V.S., Tejero M.E., Proffitt J.M., Cole S.A.,Freeland-Graves J.H., Comuzzie A.G.; "Quantitative genetic analysis and characterization of ghrelin inbaboons."; Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases.
Domain Name	Motilin_assoc  Motilin_ghrelin
Hormone Name	Obestatin
Mature Hormone Sequence	FNAPFDVGIKLSGVQYQQHSQAL
Position of mature hormone in Pre-Hormone protein	23 Residues from position (76-98)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 27

HMRbase accession number	10705
Swiss-prot Accession number	Q9GL67 (Sequence in FASTA format)
Description	Parathyroid hormone precursor (Parathyrin) (PTH).
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the parathyroid hormone family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion
Protein Length	115 Amino acids
Molecular weight	12921
References	1   Toribio R.E., Kohn C.W., Leone G.W., Capen C.C., Rosol T.J.; "Molecular cloning of feline preproparathyroid hormone."; Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases.
Domain Name	Parathyroid
Hormone Name	Parathyroid hormone (Parathyrin) (PTH)
Mature Hormone Sequence	SVSEIQFMHNLGKHLSSVERVEWLRRKLQDVHNFVALGAPIAHRDGGSQRPRKKEDNVPAENHQKSLGEADKADVDVLIKAKSQ
Position of mature hormone in Pre-Hormone protein	84 Residues from position (32-115)
Receptor	N/A
Gene ID	493684
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 28

HMRbase accession number	10709
Swiss-prot Accession number	Q07370 (Sequence in FASTA format)
Description	Growth hormone variant precursor (GH-V) (Placenta-specific growthhormone) (Growth hormone 2).
Source organism	Macaca mulatta (Rhesus macaque)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	Expressed in the placenta
Post translational modification	N/A
Function	Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues
Protein Length	217 Amino acids
Molecular weight	25221
References	1   Golos T.G.; Submitted (JAN-1994) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 8404617
Domain Name	Hormone_1
Hormone Name	Growth hormone variant
Mature Hormone Sequence	FPTIPLSWLFNTAVFRAHHLHKLAFDTYPKLEEAYIPKEQKYSFLRNPQTSLCFSESIPTPSNKEETQQKSNLELLHISLLLIQSWLEPVQFLRSVFANHLVHTNSNFDIYLYLKKLEEGIQTLMERLEDGSPRTGQIFKETYSKYDTNSHNDDTLLKNYRLLYCFRKDMNKVETFLRTVRCRAVEGSCGF
Position of mature hormone in Pre-Hormone protein	191 Residues from position (27-217)
Receptor	N/A
Gene ID	700885
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 29

HMRbase accession number	10775
Swiss-prot Accession number	Q7ZZV4 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Anguilla japonica (Japanese eel)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Anguilliformes; Anguillidae;Anguilla.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism. May play some role in the biological processes of the immature fishes
Protein Length	147 Amino acids
Molecular weight	16088
References	1   Han Y.-S., Liao I.-C., Tzeng W.-N., Huang Y.-S., Yu J.Y.-L.; "Molecular cloning of the genomic DNA and cDNA encoding thyroidstimulating hormone beta subunit of the Japanese eel and its geneexpression."; Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases. 2   Nagae M., Qu X.C., Kazeto Y., Ijiri S., Ito F., Adachi S.,Yamauchi K.; "Molecular cloning of Japanese eel TSH beta."; Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	ICSPVDYTLYVEKPECDFCVAINTTICMGFCYSLDPNVVGPAVKRLAVQRGCTYQAVEYRTAELPGCPPHVDPRFSYPVALHCTCRACDPARDECTHRASADGDRCSKPLLLHMHAYPGQSNHIQTL
Position of mature hormone in Pre-Hormone protein	127 Residues from position (21-147)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 30

HMRbase accession number	10983
Swiss-prot Accession number	Q8HY83 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Capra hircus (Goat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Capra.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14688
References	1   Guan H.-B., Li Q.-Z., Zhang L.; "Nucleotide sequence of cloned cDNA for beta subunit of Cervus nipponfollicle stimulating hormone."; Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases. 2   Ding J.T., Zhang J.Q., Sun H.C., Jiang X.P.; "Cloning and DNA sequence analysis of the cDNA for goat folliclestimulating hormone."; Submitted (JUN-2002) to the EMBL/GenBank/DDBJ databases. 3   Guan H.-B., Li Q.-Z., Zhang L.; "Nucleotide sequence of cloned cDNA for beta subunit of Cervus nipponfollicle stimulating hormone."; Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases. 4   Ding J.T., Zhang J.Q., Sun H.C., Jiang X.P.; "Cloning and DNA sequence analysis of the cDNA for goat folliclestimulating hormone."; Submitted (JUN-2002) to the EMBL/GenBank/DDBJ databases.
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	RSCELTNITITVEKEECSFCISINTTWCAGYCYTRDLVYKDPARPNIQKACTFKELVYETVKVPGCARHADSLYTYPVATECHCGKCDRDSTDCTVRGLGPSYCSFSDIRE
Position of mature hormone in Pre-Hormone protein	111 Residues from position (19-129)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 31

HMRbase accession number	10984
Swiss-prot Accession number	A1BN60 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Gorilla gorilla gorilla (Lowland gorilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Gorilla.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14686
References	1  PubMed abstract 17227474 2  PubMed abstract 17227474
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Position of mature hormone in Pre-Hormone protein	Residues from position 109
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 32

HMRbase accession number	10985
Swiss-prot Accession number	A1BN61 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Pongo pygmaeus (Orangutan)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pongo.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14672
References	1  PubMed abstract 17227474 2  PubMed abstract 17227474
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Position of mature hormone in Pre-Hormone protein	Residues from position 109
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 33

HMRbase accession number	10991
Swiss-prot Accession number	P68267 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha).
Source organism	Macropus rufus (Red kangaroo) (Megaleia rufa)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Diprotodontia; Macropodidae; Macropus.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	120 Amino acids
Molecular weight	13513
References	1  PubMed abstract 9680384 2  PubMed abstract 9680384
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	FPDGEFIMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS
Position of mature hormone in Pre-Hormone protein	96 Residues from position (25-120)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 34

HMRbase accession number	10995
Swiss-prot Accession number	P68268 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha).
Source organism	Trichosurus vulpecula (Brush-tailed possum)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Diprotodontia; Phalangeridae; Trichosurus.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	Detected in pituitary
Post translational modification	N/A
Function	N/A
Protein Length	120 Amino acids
Molecular weight	13513
References	1  PubMed abstract 9680384 2  PubMed abstract 9687157 3  PubMed abstract 9680384 4  PubMed abstract 9687157
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	FPDGEFIMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS
Position of mature hormone in Pre-Hormone protein	96 Residues from position (25-120)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 35

HMRbase accession number	11102
Swiss-prot Accession number	P68260 (Sequence in FASTA format)
Description	Glucagon.
Source organism	Meleagris gallopavo (Common turkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis
Protein Length	29 Amino acids
Molecular weight	3456
References	1  PubMed abstract 4645932
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMST
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 36

HMRbase accession number	11118
Swiss-prot Accession number	P68274 (Sequence in FASTA format)
Description	Glucagon.
Source organism	Oryctolagus cuniculus (Rabbit)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis
Protein Length	29 Amino acids
Molecular weight	3483
References	1  PubMed abstract 5011077
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 37

HMRbase accession number	11123
Swiss-prot Accession number	P68275 (Sequence in FASTA format)
Description	Glucagon.
Source organism	Saimiri sciureus (Common squirrel monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Platyrrhini; Cebidae; Saimiriinae; Saimiri.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis
Protein Length	29 Amino acids
Molecular weight	3483
References	1  PubMed abstract 2263627
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 38

HMRbase accession number	11163
Swiss-prot Accession number	O93464 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK8) [Contains: Cholecystokinin 8 (CCK8);Cholecystokinin 12 (CCK12); Cholecystokinin 26 (CCK26);Cholecystokinin 36 (CCK36); Cholecystokinin 69 (CCK69)].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted (Potential)
Developmental Stage	Expression in the brain shows variation throughout the seasonal sexual cycle; in the optic tectum-thalamus of females, expression levels are lower in early gonadal recrudescence (October) compared to other sexual stages. In males, expression is high in the olfactory bulbs in early gonadal recrudescence and low in the posterior brain in late gonadal recrudescence (January). Expression is higher in females than males in the telencephalon-preoptic region and posterior brain during late gonadal recrudescence, and in the olfactory bulbs and optic tectum-thalamus during the sexually mature (April), and post-spawning and sexually regressed (July) stages.
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in the ovary, kidney, gill, gastrointestinal tract and pituitary. Differentially expressed in the brain in the optic tectum-thalamus, hypothalamus, telencephalon, olfactory bulb and tract, preoptic region and posterior brain region. Expression is strongest in the hypothalamus, where localization is to the posterior ventrolateral region. Expression in the brain is transiently increased 2 hours after feeding. Abundant in the sensory layers of the vagal lobe and along the border of the sensory region of the lobe and the deep fiber laye. Also present in the facial lobe and throughout the glossopharyngeal lobe
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut (By similarity). Induces the secretion of gonadotropin and growth hormone from the pituitary. Suppresses food intake and decreases the expression of preprosomatostatin genes in the forebrain
Protein Length	123 Amino acids
Molecular weight	13439
References	1  PubMed abstract 9493851 2  PubMed abstract 8262360 3  PubMed abstract 8092330 4  PubMed abstract 10640690 5  PubMed abstract 12124755 6  PubMed abstract 14751584 7  PubMed abstract 15256279
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	LSLPAVSEDGGQSDLGIVMEHTRHTRAAPSSGQLSLLSKAEDDEEPRSSLTELLARIISTKGTYRRSPSPKSKSMGNNHRIKDRDYLGWMDFGRRSAEEYEYSS
Position of mature hormone in Pre-Hormone protein	104 Residues from position (20-123)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 39

HMRbase accession number	11165
Swiss-prot Accession number	O93464 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK8) [Contains: Cholecystokinin 8 (CCK8);Cholecystokinin 12 (CCK12); Cholecystokinin 26 (CCK26);Cholecystokinin 36 (CCK36); Cholecystokinin 69 (CCK69)].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted (Potential)
Developmental Stage	Expression in the brain shows variation throughout the seasonal sexual cycle; in the optic tectum-thalamus of females, expression levels are lower in early gonadal recrudescence (October) compared to other sexual stages. In males, expression is high in the olfactory bulbs in early gonadal recrudescence and low in the posterior brain in late gonadal recrudescence (January). Expression is higher in females than males in the telencephalon-preoptic region and posterior brain during late gonadal recrudescence, and in the olfactory bulbs and optic tectum-thalamus during the sexually mature (April), and post-spawning and sexually regressed (July) stages.
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in the ovary, kidney, gill, gastrointestinal tract and pituitary. Differentially expressed in the brain in the optic tectum-thalamus, hypothalamus, telencephalon, olfactory bulb and tract, preoptic region and posterior brain region. Expression is strongest in the hypothalamus, where localization is to the posterior ventrolateral region. Expression in the brain is transiently increased 2 hours after feeding. Abundant in the sensory layers of the vagal lobe and along the border of the sensory region of the lobe and the deep fiber laye. Also present in the facial lobe and throughout the glossopharyngeal lobe
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut (By similarity). Induces the secretion of gonadotropin and growth hormone from the pituitary. Suppresses food intake and decreases the expression of preprosomatostatin genes in the forebrain
Protein Length	123 Amino acids
Molecular weight	13439
References	1  PubMed abstract 9493851 2  PubMed abstract 8262360 3  PubMed abstract 8092330 4  PubMed abstract 10640690 5  PubMed abstract 12124755 6  PubMed abstract 14751584 7  PubMed abstract 15256279
Domain Name	Gastrin
Hormone Name	Cholecystokinin 69
Mature Hormone Sequence	HTRAAPSSGQLSLLSKAEDDEEPRSSLTELLARIISTKGTYRRSPSPKSKSMGNNHRIKDRDYLGWMDF
Position of mature hormone in Pre-Hormone protein	69 Residues from position (43-111)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 40

HMRbase accession number	11166
Swiss-prot Accession number	O93464 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK8) [Contains: Cholecystokinin 8 (CCK8);Cholecystokinin 12 (CCK12); Cholecystokinin 26 (CCK26);Cholecystokinin 36 (CCK36); Cholecystokinin 69 (CCK69)].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted (Potential)
Developmental Stage	Expression in the brain shows variation throughout the seasonal sexual cycle; in the optic tectum-thalamus of females, expression levels are lower in early gonadal recrudescence (October) compared to other sexual stages. In males, expression is high in the olfactory bulbs in early gonadal recrudescence and low in the posterior brain in late gonadal recrudescence (January). Expression is higher in females than males in the telencephalon-preoptic region and posterior brain during late gonadal recrudescence, and in the olfactory bulbs and optic tectum-thalamus during the sexually mature (April), and post-spawning and sexually regressed (July) stages.
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in the ovary, kidney, gill, gastrointestinal tract and pituitary. Differentially expressed in the brain in the optic tectum-thalamus, hypothalamus, telencephalon, olfactory bulb and tract, preoptic region and posterior brain region. Expression is strongest in the hypothalamus, where localization is to the posterior ventrolateral region. Expression in the brain is transiently increased 2 hours after feeding. Abundant in the sensory layers of the vagal lobe and along the border of the sensory region of the lobe and the deep fiber laye. Also present in the facial lobe and throughout the glossopharyngeal lobe
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut (By similarity). Induces the secretion of gonadotropin and growth hormone from the pituitary. Suppresses food intake and decreases the expression of preprosomatostatin genes in the forebrain
Protein Length	123 Amino acids
Molecular weight	13439
References	1  PubMed abstract 9493851 2  PubMed abstract 8262360 3  PubMed abstract 8092330 4  PubMed abstract 10640690 5  PubMed abstract 12124755 6  PubMed abstract 14751584 7  PubMed abstract 15256279
Domain Name	Gastrin
Hormone Name	Cholecystokinin 36
Mature Hormone Sequence	IISTKGTYRRSPSPKSKSMGNNHRIKDRDYLGWMDF
Position of mature hormone in Pre-Hormone protein	36 Residues from position (76-111)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 41

HMRbase accession number	11167
Swiss-prot Accession number	O93464 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK8) [Contains: Cholecystokinin 8 (CCK8);Cholecystokinin 12 (CCK12); Cholecystokinin 26 (CCK26);Cholecystokinin 36 (CCK36); Cholecystokinin 69 (CCK69)].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted (Potential)
Developmental Stage	Expression in the brain shows variation throughout the seasonal sexual cycle; in the optic tectum-thalamus of females, expression levels are lower in early gonadal recrudescence (October) compared to other sexual stages. In males, expression is high in the olfactory bulbs in early gonadal recrudescence and low in the posterior brain in late gonadal recrudescence (January). Expression is higher in females than males in the telencephalon-preoptic region and posterior brain during late gonadal recrudescence, and in the olfactory bulbs and optic tectum-thalamus during the sexually mature (April), and post-spawning and sexually regressed (July) stages.
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in the ovary, kidney, gill, gastrointestinal tract and pituitary. Differentially expressed in the brain in the optic tectum-thalamus, hypothalamus, telencephalon, olfactory bulb and tract, preoptic region and posterior brain region. Expression is strongest in the hypothalamus, where localization is to the posterior ventrolateral region. Expression in the brain is transiently increased 2 hours after feeding. Abundant in the sensory layers of the vagal lobe and along the border of the sensory region of the lobe and the deep fiber laye. Also present in the facial lobe and throughout the glossopharyngeal lobe
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut (By similarity). Induces the secretion of gonadotropin and growth hormone from the pituitary. Suppresses food intake and decreases the expression of preprosomatostatin genes in the forebrain
Protein Length	123 Amino acids
Molecular weight	13439
References	1  PubMed abstract 9493851 2  PubMed abstract 8262360 3  PubMed abstract 8092330 4  PubMed abstract 10640690 5  PubMed abstract 12124755 6  PubMed abstract 14751584 7  PubMed abstract 15256279
Domain Name	Gastrin
Hormone Name	Cholecystokinin 26
Mature Hormone Sequence	SPSPKSKSMGNNHRIKDRDYLGWMDF
Position of mature hormone in Pre-Hormone protein	26 Residues from position (86-111)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 42

HMRbase accession number	11168
Swiss-prot Accession number	O93464 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK8) [Contains: Cholecystokinin 8 (CCK8);Cholecystokinin 12 (CCK12); Cholecystokinin 26 (CCK26);Cholecystokinin 36 (CCK36); Cholecystokinin 69 (CCK69)].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted (Potential)
Developmental Stage	Expression in the brain shows variation throughout the seasonal sexual cycle; in the optic tectum-thalamus of females, expression levels are lower in early gonadal recrudescence (October) compared to other sexual stages. In males, expression is high in the olfactory bulbs in early gonadal recrudescence and low in the posterior brain in late gonadal recrudescence (January). Expression is higher in females than males in the telencephalon-preoptic region and posterior brain during late gonadal recrudescence, and in the olfactory bulbs and optic tectum-thalamus during the sexually mature (April), and post-spawning and sexually regressed (July) stages.
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in the ovary, kidney, gill, gastrointestinal tract and pituitary. Differentially expressed in the brain in the optic tectum-thalamus, hypothalamus, telencephalon, olfactory bulb and tract, preoptic region and posterior brain region. Expression is strongest in the hypothalamus, where localization is to the posterior ventrolateral region. Expression in the brain is transiently increased 2 hours after feeding. Abundant in the sensory layers of the vagal lobe and along the border of the sensory region of the lobe and the deep fiber laye. Also present in the facial lobe and throughout the glossopharyngeal lobe
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut (By similarity). Induces the secretion of gonadotropin and growth hormone from the pituitary. Suppresses food intake and decreases the expression of preprosomatostatin genes in the forebrain
Protein Length	123 Amino acids
Molecular weight	13439
References	1  PubMed abstract 9493851 2  PubMed abstract 8262360 3  PubMed abstract 8092330 4  PubMed abstract 10640690 5  PubMed abstract 12124755 6  PubMed abstract 14751584 7  PubMed abstract 15256279
Domain Name	Gastrin
Hormone Name	Cholecystokinin 12
Mature Hormone Sequence	IKDRDYLGWMDF
Position of mature hormone in Pre-Hormone protein	12 Residues from position (100-111)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 43

HMRbase accession number	11169
Swiss-prot Accession number	O93464 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK8) [Contains: Cholecystokinin 8 (CCK8);Cholecystokinin 12 (CCK12); Cholecystokinin 26 (CCK26);Cholecystokinin 36 (CCK36); Cholecystokinin 69 (CCK69)].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted (Potential)
Developmental Stage	Expression in the brain shows variation throughout the seasonal sexual cycle; in the optic tectum-thalamus of females, expression levels are lower in early gonadal recrudescence (October) compared to other sexual stages. In males, expression is high in the olfactory bulbs in early gonadal recrudescence and low in the posterior brain in late gonadal recrudescence (January). Expression is higher in females than males in the telencephalon-preoptic region and posterior brain during late gonadal recrudescence, and in the olfactory bulbs and optic tectum-thalamus during the sexually mature (April), and post-spawning and sexually regressed (July) stages.
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in the ovary, kidney, gill, gastrointestinal tract and pituitary. Differentially expressed in the brain in the optic tectum-thalamus, hypothalamus, telencephalon, olfactory bulb and tract, preoptic region and posterior brain region. Expression is strongest in the hypothalamus, where localization is to the posterior ventrolateral region. Expression in the brain is transiently increased 2 hours after feeding. Abundant in the sensory layers of the vagal lobe and along the border of the sensory region of the lobe and the deep fiber laye. Also present in the facial lobe and throughout the glossopharyngeal lobe
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut (By similarity). Induces the secretion of gonadotropin and growth hormone from the pituitary. Suppresses food intake and decreases the expression of preprosomatostatin genes in the forebrain
Protein Length	123 Amino acids
Molecular weight	13439
References	1  PubMed abstract 9493851 2  PubMed abstract 8262360 3  PubMed abstract 8092330 4  PubMed abstract 10640690 5  PubMed abstract 12124755 6  PubMed abstract 14751584 7  PubMed abstract 15256279
Domain Name	Gastrin
Hormone Name	Cholecystokinin 8
Mature Hormone Sequence	DYLGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (104-111)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 44

HMRbase accession number	11181
Swiss-prot Accession number	O57312 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 8 (CCK8)].
Source organism	Paralichthys olivaceus (Japanese flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Paralichthyidae; Paralichthys.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	135 Amino acids
Molecular weight	14773
References	1  PubMed abstract 11042006
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	HPISSQHLDEGQRSISTPSEALLEADTHSLGEPHLRQSRSAPQLKSLPVAEEDGDSRANLSELLARLISSRKGSVRRNSTAYSKGLSPNHRIADRDYLGWMDFGRRSAEEYEYSS
Position of mature hormone in Pre-Hormone protein	115 Residues from position (21-135)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 45

HMRbase accession number	11182
Swiss-prot Accession number	O57312 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 8 (CCK8)].
Source organism	Paralichthys olivaceus (Japanese flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Paralichthyidae; Paralichthys.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	135 Amino acids
Molecular weight	14773
References	1  PubMed abstract 11042006
Domain Name	Gastrin
Hormone Name	Cholecystokinin 8
Mature Hormone Sequence	DYLGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (116-123)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 46

HMRbase accession number	11240
Swiss-prot Accession number	O97655 (Sequence in FASTA format)
Description	Progonadoliberin-2 precursor (Progonadoliberin II) [Contains:Gonadoliberin-2 (Gonadoliberin II) (Luteinizing hormone-releasinghormone II) (LH-RH II) (Gonadotropin-releasing hormone II) (GnRH II)(Luliberin II); GnRH-associated peptide 2 (GnRH-associated peptideII)].
Source organism	Macaca mulatta (Rhesus macaque)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones
Protein Length	114 Amino acids
Molecular weight	12533
References	1   White R.B., Urbanski H.F., Fernald R.D.; "A second gene for gonadotropin-releasing hormone is expressed in therhesus macaque (Abstract 2   632.18)."; Abstr. - Soc. Neurosci. 24:1609-1609(1998). 3   Abler L.A., Sherwood N.M., Grendell R.L., Golos T.G., Terasawa E.; "cDNA of a second form of luteinizing hormone releasing, chicken LHRH-II, isolated from the non-human primate brain (Abstract 4   632.8)."; Abstr. - Soc. Neurosci. 24:1607-1607(1998).
Domain Name	N/A
Hormone Name	Gonadoliberin-2
Mature Hormone Sequence	QHWSHGWYPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (25-34)
Receptor	Q8SPZ1   Detail in HMRbase    Q95JG1    Detail in HMRbase
Gene ID	619516
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 47

HMRbase accession number	11434
Swiss-prot Accession number	P27106 (Sequence in FASTA format)
Description	Muellerian-inhibiting factor precursor (MIS) (Anti-Muellerian hormone)(AMH) (Muellerian-inhibiting substance).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the TGF-beta family.
Tissue Specificity	Sertoli cells of fetal testes, and testes just after birth, but absent in adult testes. In female, AMH is expressed after birth in the granulosa cells of the follicle. AMH expression is dependent on the degree of follicular maturation and not on the age of the ovary
Post translational modification	N/A
Function	This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin
Protein Length	555 Amino acids
Molecular weight	59778
References	1  PubMed abstract 1782869 2   Dresser D.W., Jamin S., Atkins C.J., Guerrier D.; "A GNRP-like gene shares a bidirectional promoter with SAP62immediately upstream of AMH."; Submitted (SEP-2000) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 8541848
Domain Name	N/A
Hormone Name	Muellerian-inhibiting factor
Mature Hormone Sequence	N/A
Position of mature hormone in Pre-Hormone protein	N/A Residues from position
Receptor	Q8K592    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 48

HMRbase accession number	11466
Swiss-prot Accession number	P49000 (Sequence in FASTA format)
Description	Muellerian-inhibiting factor precursor (MIS) (Anti-Muellerian hormone)(AMH) (Muellerian-inhibiting substance).
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the TGF-beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin
Protein Length	553 Amino acids
Molecular weight	58889
References	1  PubMed abstract 1572639
Domain Name	N/A
Hormone Name	Muellerian-inhibiting factor
Mature Hormone Sequence	N/A
Position of mature hormone in Pre-Hormone protein	N/A Residues from position
Receptor	Q62893    Detail in HMRbase
Gene ID	25378
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 49

HMRbase accession number	11471
Swiss-prot Accession number	P50144 (Sequence in FASTA format)
Description	Cholecystokinin type 1 precursor [Contains: Cholecystokinin (CCK)].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Brain, gastrointestinal tract and lung
Post translational modification	N/A
Function	N/A
Protein Length	123 Amino acids
Molecular weight	13943
References	1  PubMed abstract 7669225
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	DYMGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (104-111)
Receptor	P70031    Detail in HMRbase
Gene ID	378611
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 50

HMRbase accession number	11472
Swiss-prot Accession number	P50145 (Sequence in FASTA format)
Description	Cholecystokinin type 2 precursor [Contains: Cholecystokinin (CCK)].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Brain and gastrointestinal tract
Post translational modification	N/A
Function	N/A
Protein Length	128 Amino acids
Molecular weight	14201
References	1  PubMed abstract 7669225
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	DYMGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (109-116)
Receptor	P70031    Detail in HMRbase
Gene ID	378612
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 51

HMRbase accession number	11482
Swiss-prot Accession number	P56942 (Sequence in FASTA format)
Description	Pro-MCH precursor [Contains: Neuropeptide-glycine-glutamic acid (NGE)(Neuropeptide G-E); Neuropeptide-glutamic acid-isoleucine (NEI)(Neuropeptide E-I); Melanin-concentrating hormone (MCH)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	Expression is enhanced between postnatal days 10 and 15.
Similarity	Belongs to the MCH family.
Tissue Specificity	Predominantly expressed in hypothalamus. Also found in heart, intestine, spleen and testis (spermatogonia, early spermatocytes and Sertoli cells). In brain only mature MCH and NEI peptides are present. In peripheral tissues a large product, encompassing the NEI and MCH domains of the precursor, is found predominantly
Post translational modification	Pro-MCH is processed differentially in the brain and in peripheral organs producing two neuropeptides; NEI and MCH. A third peptide, NGE, may also be produced. Preferential processing in neurons by prohormone convertase 2 (PC2) generates NEI. MCH is generated in neurons of the lateral hypothalmic area by several prohormone convertases including PC1/3, PC2 and PC5/6. MCH is a cyclic peptide.
Function	N/A
Protein Length	166 Amino acids
Molecular weight	18645
References	1   Breton C., Presse F., Hervieu G., Nahon J.-L.; "Structure and regulation of the mouse melanin-concentrating hormonemRNA and gene."; Mol. Cell. Neurosci. 4:271-284(1993). 2  PubMed abstract 10037747 3  PubMed abstract 8724342
Domain Name	Pro-MCH
Hormone Name	Neuropeptide-glutamic acid-isoleucine
Mature Hormone Sequence	EIGDEENSAKFPI
Position of mature hormone in Pre-Hormone protein	13 Residues from position (132-144)
Receptor	Q8K3M8   Detail in HMRbase    Q3UY93    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 52

HMRbase accession number	11483
Swiss-prot Accession number	P56942 (Sequence in FASTA format)
Description	Pro-MCH precursor [Contains: Neuropeptide-glycine-glutamic acid (NGE)(Neuropeptide G-E); Neuropeptide-glutamic acid-isoleucine (NEI)(Neuropeptide E-I); Melanin-concentrating hormone (MCH)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	Expression is enhanced between postnatal days 10 and 15.
Similarity	Belongs to the MCH family.
Tissue Specificity	Predominantly expressed in hypothalamus. Also found in heart, intestine, spleen and testis (spermatogonia, early spermatocytes and Sertoli cells). In brain only mature MCH and NEI peptides are present. In peripheral tissues a large product, encompassing the NEI and MCH domains of the precursor, is found predominantly
Post translational modification	Pro-MCH is processed differentially in the brain and in peripheral organs producing two neuropeptides; NEI and MCH. A third peptide, NGE, may also be produced. Preferential processing in neurons by prohormone convertase 2 (PC2) generates NEI. MCH is generated in neurons of the lateral hypothalmic area by several prohormone convertases including PC1/3, PC2 and PC5/6. MCH is a cyclic peptide.
Function	MCH may act as a neurotransmitter or neuromodulator in a broad array of neuronal functions directed toward the regulation of goal-directed behavior, such as food intake, and general arousal
Protein Length	166 Amino acids
Molecular weight	18645
References	1   Breton C., Presse F., Hervieu G., Nahon J.-L.; "Structure and regulation of the mouse melanin-concentrating hormonemRNA and gene."; Mol. Cell. Neurosci. 4:271-284(1993). 2  PubMed abstract 10037747 3  PubMed abstract 8724342
Domain Name	Pro-MCH
Hormone Name	Melanin-concentrating hormone
Mature Hormone Sequence	DFDMLRCMLGRVYRPCWQV
Position of mature hormone in Pre-Hormone protein	19 Residues from position (148-166)
Receptor	Q8K3M8   Detail in HMRbase    Q3UY93    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 53

HMRbase accession number	11503
Swiss-prot Accession number	Q5XXR2 (Sequence in FASTA format)
Description	Pro-MCH precursor [Contains: Neuropeptide-glycine-glutamic acid (NGE)(Neuropeptide G-E); Neuropeptide-glutamic acid-isoleucine (NEI)(Neuropeptide E-I); Melanin-concentrating hormone (MCH)].
Source organism	Canis familiaris (Dog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the melanin-concentrating hormone family.
Tissue Specificity	N/A
Post translational modification	Pro-MCH is processed differentially in the brain and in peripheral organs producing two neuropeptides; NEI and MCH. A third peptide, NGE, may also be produced. Preferential processing in neurons by prohormone convertase 2 (PC2) generates NEI. MCH is generated in neurons of the lateral hypothalmic area by several prohormone convertases including PC1/3, PC2 and PC5/6 (By similarity). MCH is a cyclic peptide (By similarity).
Function	N/A
Protein Length	165 Amino acids
Molecular weight	18644
References	1   Steflik J., Waters S.M.; "Canine pro-melanin-concentrating hormone."; Submitted (AUG-2004) to the EMBL/GenBank/DDBJ databases.
Domain Name	Pro-MCH
Hormone Name	Neuropeptide-glutamic acid-isoleucine
Mature Hormone Sequence	EIGDEENSAKFPI
Position of mature hormone in Pre-Hormone protein	13 Residues from position (131-143)
Receptor	Q8MIP5   Detail in HMRbase    Q8MIP6    Detail in HMRbase
Gene ID	449022
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 54

HMRbase accession number	11505
Swiss-prot Accession number	Q812B2 (Sequence in FASTA format)
Description	Glycoprotein hormone beta-5 precursor (Thyrostimulin subunit beta).
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	Expressed in the anterior lobe of pituitary
Post translational modification	N/A
Function	Stimulates the thyroid. Binds and activates THSR, leading to increased cAMP production
Protein Length	130 Amino acids
Molecular weight	14249
References	1   Feldhaus A., Holloway J.L., O'Hogan S.L., Tackett M., Taft D.,Thayer E.C., Webster P.; "A novel glycoprotein hormone beta subunit."; Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 16141072 3  PubMed abstract 16210345
Domain Name	Cys_knot
Hormone Name	Glycoprotein hormone beta-5
Mature Hormone Sequence	SSSGNLHTFVGCAVREFTFMAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVDPFYTYPMAVRCDCGACSTATTECETI
Position of mature hormone in Pre-Hormone protein	106 Residues from position (25-130)
Receptor	P47750    Detail in HMRbase
Gene ID	217674
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 55

HMRbase accession number	11522
Swiss-prot Accession number	P50595 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
Protein Length	167 Amino acids
Molecular weight	18716
References	1  PubMed abstract 10594237 2  PubMed abstract 14629116 3  PubMed abstract 16305752 4  PubMed abstract 8661738
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	Q32PD8   Detail in HMRbase    Q3SYT0   Detail in HMRbase    Q59HQ0   Detail in HMRbase    Q5KQU4   Detail in HMRbase    Q5KQU5    Detail in HMRbase
Gene ID	280836
PDB ID	2A16
Drugpedia	wiki
Comments

Search Result - 56

HMRbase accession number	11523
Swiss-prot Accession number	Q5J732 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Bubalus bubalis (Domestic water buffalo)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bubalus.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass (By similarity).
Protein Length	167 Amino acids
Molecular weight	18688
References	1  PubMed abstract 15566470
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 57

HMRbase accession number	11524
Swiss-prot Accession number	O02720 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Canis familiaris (Dog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass (By similarity).
Protein Length	167 Amino acids
Molecular weight	18655
References	----
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	Q4W810   Detail in HMRbase
Gene ID	403616
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 58

HMRbase accession number	11525
Swiss-prot Accession number	Q257X2 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Capra hircus (Goat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Capra.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass (By similarity).
Protein Length	167 Amino acids
Molecular weight	18700
References	----
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 59

HMRbase accession number	11526
Swiss-prot Accession number	O42164 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Gallus gallus (Chicken)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	Not exclusively localized in adipose tissue but is also expressed in liver
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass (By similarity).
Protein Length	163 Amino acids
Molecular weight	18183
References	1  PubMed abstract 9524275
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	Q9I8V6   Detail in HMRbase    Q9IBA7   Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 60

HMRbase accession number	11527
Swiss-prot Accession number	Q9N2C1 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass (By similarity).
Protein Length	167 Amino acids
Molecular weight	18584
References	----
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	493838
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 61

HMRbase accession number	11528
Swiss-prot Accession number	Q588G0 (Sequence in FASTA format)
Description	Leptin; Precursor
Source organism	Fugu rubripes (Japanese pufferfish) (Takifugu rubripes)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Tetraodontiformes;Tetradontoidea; Tetraodontidae; Takifugu.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	Expressed mostly in the liver
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot (By similarity).
Protein Length	152 Amino acids
Molecular weight	17204
References	1  PubMed abstract 15808904
Domain Name	N/A
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	B3Y063   Detail in HMRbase    B3Y064   Detail in HMRbase    B3Y065   Detail in HMRbase
Gene ID	548631
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 62

HMRbase accession number	11529
Swiss-prot Accession number	Q95189 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor
Source organism	Gorilla gorilla gorilla (Lowland gorilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Gorilla.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass (By similarity).
Protein Length	146 Amino acids
Molecular weight	16031
References	----
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 63

HMRbase accession number	11530
Swiss-prot Accession number	Q706D0 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Halichoerus grypus (Gray seal)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Phocidae;Halichoerus.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass (By similarity).
Protein Length	167 Amino acids
Molecular weight	18483
References	----
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 64

HMRbase accession number	11532
Swiss-prot Accession number	Q28504 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Macaca mulatta (Rhesus macaque)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
Protein Length	167 Amino acids
Molecular weight	18953
References	1  PubMed abstract 8810296
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	Q9MYL0   Detail in HMRbase
Gene ID	698728
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 65

HMRbase accession number	11533
Swiss-prot Accession number	P41160 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
Protein Length	167 Amino acids
Molecular weight	18709
References	1  PubMed abstract 7984236
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	P48356   Detail in HMRbase    Q9CQ74   Detail in HMRbase    O89013   Detail in HMRbase    A2AV64   Detail in HMRbase    A2AV69   Detail in HMRbase    Q3UNU8   Detail in HMRbase    Q3US58   Detail in HMRbase    Q545G9   Detail in HMRbase
Gene ID	16846
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 66

HMRbase accession number	11534
Swiss-prot Accession number	Q588F9 (Sequence in FASTA format)
Description	Leptin; Precursor
Source organism	Oryzias latipes (Medaka fish) (Japanese ricefish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Atherinomorpha;Beloniformes; Adrianichthyidae; Oryziinae; Oryzias.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot (By similarity).
Protein Length	155 Amino acids
Molecular weight	17291
References	1  PubMed abstract 15808904
Domain Name	N/A
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	100049298
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 67

HMRbase accession number	11535
Swiss-prot Accession number	O02750 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor
Source organism	Pan troglodytes (Chimpanzee)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass (By similarity).
Protein Length	146 Amino acids
Molecular weight	16059
References	----
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 68

HMRbase accession number	11536
Swiss-prot Accession number	Q706D1 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Phoca vitulina (Harbor seal)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Phocidae;Phoca.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass (By similarity).
Protein Length	167 Amino acids
Molecular weight	18411
References	----
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 69

HMRbase accession number	11537
Swiss-prot Accession number	Q29406 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
Protein Length	167 Amino acids
Molecular weight	18661
References	1  PubMed abstract 8856925
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	O02671   Detail in HMRbase
Gene ID	396832
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 70

HMRbase accession number	11538
Swiss-prot Accession number	Q95234 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor
Source organism	Pongo pygmaeus (Bornean orangutan)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pongo.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass (By similarity).
Protein Length	146 Amino acids
Molecular weight	16195
References	----
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 71

HMRbase accession number	11539
Swiss-prot Accession number	P50596 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of Lep may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
Protein Length	167 Amino acids
Molecular weight	18866
References	1  PubMed abstract 7657834 2  PubMed abstract 7794258 3  PubMed abstract 7733988
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	Q62959   Detail in HMRbase    Q9JLS8   Detail in HMRbase    Q6PDU4   Detail in HMRbase
Gene ID	25608
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 72

HMRbase accession number	11540
Swiss-prot Accession number	Q28603 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
Protein Length	146 Amino acids
Molecular weight	16054
References	1  PubMed abstract 9347250
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	Q863E2   Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 73

HMRbase accession number	11541
Swiss-prot Accession number	Q9XSW9 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Sminthopsis crassicaudata (Fat-tailed dunnart)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sminthopsis.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass (By similarity).
Protein Length	167 Amino acids
Molecular weight	18891
References	1  PubMed abstract 11060440
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 74

HMRbase accession number	11542
Swiss-prot Accession number	Q588F8 (Sequence in FASTA format)
Description	Leptin; Precursor
Source organism	Tetraodon nigroviridis (Green puffer)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Tetraodontiformes;Tetradontoidea; Tetraodontidae; Tetraodon.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot (By similarity).
Protein Length	160 Amino acids
Molecular weight	18260
References	1  PubMed abstract 15808904 2  PubMed abstract 15496914
Domain Name	N/A
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 75

HMRbase accession number	11543
Swiss-prot Accession number	Q1XG29 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Ursus thibetanus (Asiatic black bear)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae;Ursus.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass (By similarity).
Protein Length	167 Amino acids
Molecular weight	18698
References	----
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 76

HMRbase accession number	11571
Swiss-prot Accession number	P06281 (Sequence in FASTA format)
Description	Renin-1; EC=3.4.23.15;Alternative Name: Angiotensinogenase;Alternative Name: Kidney renin;Precursor
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted (By similarity). Membrane (By similarity). Note=Associated to membranes via binding to ATP6AP2 (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the peptidase A1 family.
Tissue Specificity	Kidney
Post translational modification	N/A
Function	Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
Protein Length	402 Amino acids
Molecular weight	44343
References	1  PubMed abstract 6370686 2  PubMed abstract 2685761 3  PubMed abstract 2691339 4  PubMed abstract 16141072 5  PubMed abstract 15489334 6  PubMed abstract 6089205 7  PubMed abstract 6392850 8  PubMed abstract 9030738 9  PubMed abstract 6327270
Domain Name	A1_Propeptide  Asp
Hormone Name	Renin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	Q9CYN9   Detail in HMRbase
Gene ID	19701
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 77

HMRbase accession number	11573
Swiss-prot Accession number	Q9TSZ1 (Sequence in FASTA format)
Description	Renin; EC=3.4.23.15;Alternative Name: Angiotensinogenase;Precursor
Source organism	Callithrix jacchus (Common marmoset)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Platyrrhini; Cebidae; Callitrichinae; Callithrix.
Subcellular location	Secreted (By similarity). Membrane (By similarity). Note=Associated to membranes via binding to ATP6AP2 (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the peptidase A1 family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney (By similarity).
Protein Length	400 Amino acids
Molecular weight	44038
References	1  PubMed abstract 10598135
Domain Name	A1_Propeptide  Asp
Hormone Name	Renin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 78

HMRbase accession number	11574
Swiss-prot Accession number	Q6DYE7 (Sequence in FASTA format)
Description	Renin; EC=3.4.23.15;Alternative Name: Angiotensinogenase;Precursor
Source organism	Canis familiaris (Dog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis.
Subcellular location	Secreted (By similarity). Membrane (By similarity). Note=Associated to membranes via binding to ATP6AP2 (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the peptidase A1 family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney (By similarity).
Protein Length	403 Amino acids
Molecular weight	44099
References	----
Domain Name	A1_Propeptide  Asp
Hormone Name	Renin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	403838
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 79

HMRbase accession number	11576
Swiss-prot Accession number	Q6DLS0 (Sequence in FASTA format)
Description	Renin; EC=3.4.23.15;Alternative Name: Angiotensinogenase;Precursor
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted (By similarity). Membrane (By similarity). Note=Associated to membranes via binding to ATP6AP2 (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the peptidase A1 family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney (By similarity).
Protein Length	406 Amino acids
Molecular weight	45011
References	----
Domain Name	A1_Propeptide  Asp
Hormone Name	Renin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 80

HMRbase accession number	11577
Swiss-prot Accession number	Q6DLW5 (Sequence in FASTA format)
Description	Renin; EC=3.4.23.15;Alternative Name: Angiotensinogenase;Precursor
Source organism	Macaca mulatta (Rhesus macaque)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted (By similarity). Membrane (By similarity). Note=Associated to membranes via binding to ATP6AP2 (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the peptidase A1 family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney (By similarity).
Protein Length	406 Amino acids
Molecular weight	44961
References	----
Domain Name	A1_Propeptide  Asp
Hormone Name	Renin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	574299
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 81

HMRbase accession number	11578
Swiss-prot Accession number	P60016 (Sequence in FASTA format)
Description	Renin; EC=3.4.23.15;Alternative Name: Angiotensinogenase;Precursor
Source organism	Pan troglodytes (Chimpanzee)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan.
Subcellular location	Secreted (By similarity). Membrane (By similarity). Note=Associated to membranes via binding to ATP6AP2 (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the peptidase A1 family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney (By similarity).
Protein Length	406 Amino acids
Molecular weight	45057
References	1  PubMed abstract 11013071
Domain Name	A1_Propeptide  Asp
Hormone Name	Renin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	469651
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 82

HMRbase accession number	11579
Swiss-prot Accession number	P08424 (Sequence in FASTA format)
Description	Renin; EC=3.4.23.15;Alternative Name: Angiotensinogenase;Precursor
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted (By similarity). Membrane (By similarity). Note=Associated to membranes via binding to ATP6AP2 (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the peptidase A1 family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
Protein Length	402 Amino acids
Molecular weight	44276
References	1  PubMed abstract 3287330 2  PubMed abstract 3039496 3  PubMed abstract 3047403 4  PubMed abstract 8490598 5  PubMed abstract 15489334
Domain Name	A1_Propeptide  Asp
Hormone Name	Renin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	Q6AXS4   Detail in HMRbase
Gene ID	24715
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 83

HMRbase accession number	11580
Swiss-prot Accession number	P52115 (Sequence in FASTA format)
Description	Renin; EC=3.4.23.15;Alternative Name: Angiotensinogenase;Precursor
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted (By similarity). Membrane (By similarity). Note=Associated to membranes via binding to ATP6AP2 (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the peptidase A1 family.
Tissue Specificity	Kidney
Post translational modification	N/A
Function	Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
Protein Length	400 Amino acids
Molecular weight	44016
References	1  PubMed abstract 1543532
Domain Name	A1_Propeptide  Asp
Hormone Name	Renin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	N/A
Gene ID	443310
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated