Fermented Food Database
This is the result page of browse. This page gives the information about peptides returned against the selected category. Further details of the peptide can be seen by clicking on the FMDB_ID. Further the user can sort the peptides on the basis of various fields by clicking on the respective headers.
The total number entries retrieved from this search are 77| FMDB_ID | PubMed ID | Reference | Title | Peptide_Sequence | Sequence | Length of peptide | Food_Matrix | Protein | pH | Temperature | Incubation Time | Activity | Experiment | Model | Assay for Activity Measurement | Culture | Hydrolysis | Method of analysis | M_Z ratio | Mass | IC50 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| FMDB31 | 25222748 | NA | NA | DVWY | DVWY | 4 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 582.5 | 0.69±0.04 mM |
| FMDB32 | 25222748 | NA | NA | FDART | FDART | 5 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 609.6 | 1.9±0.1 mM |
| FMDB33 | 25222748 | NA | NA | FQ | FQ | 2 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 294.2 | 7.4±0.6 mM |
| FMDB34 | 25222748 | NA | NA | VAE | VAE | 3 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 318 | 55.9±1.9 mM |
| FMDB35 | 25222748 | NA | NA | VVG | VVG | 3 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 274.2 | 39.6±5.7 mM |
| FMDB36 | 25222748 | NA | NA | WTFR | WTFR | 4 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 609.5 | 6.7±0.5 mM |
| FMDB800 | 16162521 | NA | NA | LEIVPK | LEIVPK | 6 | caprine kefir | αS1-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 697.4 ± 0.06 | >1000 µM |
| FMDB801 | 16162521 | NA | NA | DKIHPF | DKIHPF | 6 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 755.4 ± 0.08 | >1000 µM |
| FMDB802 | 16162521 | NA | NA | KIHPFAQAQ | KIHPFAQAQ | 9 | caprine kefir | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1038.4 ± 0.02 | 132.6 ± 14.1 µM |
| FMDB803 | 16162521 | NA | NA | QLLKLK | QLLKLK | 6 | caprine kefir | αS1-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 741.5 ± 0.08 | 342.4 ± 32.1 µM |
| FMDB804 | 16162521 | NA | NA | LNVVGETVE | LNVVGETVE | 9 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 958.3 ± 0.04 | >1000 µM |
| FMDB805 | 16162521 | NA | NA | GVPKVKETMVPK | GVPKVKETMVPK | 12 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1311.5 ± 0.04 | 376.1 ± 36.9 |
| FMDB806 | 16162521 | NA | NA | GVPKVKETMVPKH | GVPKVKETMVPKH | 13 | caprine kefir | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1448.5 ± 0.08 | 223.2 ± 21.3 |
| FMDB807 | 16162521 | NA | NA | IPAIN | IPAIN | 5 | caprine kefir | k-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 526.4 ± 0.04 | 432.6 ± 41.6 |
| FMDB808 | 16162521 | NA | NA | GPFPILV | GPFPILV | 7 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 741.5 ± 0.04 | 424.0 ± 42.4 |
| FMDB809 | 16162521 | NA | NA | KFAWPQ | KFAWPQ | 6 | caprine kefir | αS2-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 775.5 ± 0.05 | 177.1 ± 14.9 |
| FMDB810 | 16162521 | NA | NA | TGPIPNSLPQ | TGPIPNSLPQ | 10 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1022.5 ± 0.02 | >1000 |
| FMDB811 | 16162521 | NA | NA | YPF | YPF | 3 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 425.2 ± 0.02 | >1000 |
| FMDB812 | 16162521 | NA | NA | HPFAQ | HPFAQ | 5 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 598.4 ± 0.04 | 465.0 ± 43.4 |
| FMDB813 | 16162521 | NA | NA | ENLLRF | ENLLRF | 6 | caprine kefir | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 790.4 ± 0.06 | 82.4 ± 8.9 |
| FMDB814 | 16162521 | NA | NA | PYVRYL | PYVRYL | 6 | caprine kefir | αS2-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 809.4 ± 0.07 | 2.4 ± 0.2 |
| FMDB815 | 16162521 | NA | NA | LVYPFTGPIPN | LVYPFTGPIPN | 11 | caprine kefir | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1216.5 ± 0.01 | 27.9 ± 2.3 |
| FMDB838 | 21985248 | NA | NA | LQP | LQP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | ω-secalin;ω-gliadin,α-gliadin,γ gliadin,HMWglutein subunit,D-Hordein,γ hordein;C-hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus plantarum FUA 3002 | peptidase+fungal protease | LCMS/MS | 357 - 242 ( transition) | NA | 2µM |
| FMDB839 | 21985248 | NA | NA | LLP | LLP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ-75k-secalin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus plantarum FUA 3002 | peptidase+fungal protease | LCMS/MS | 342 - 116 ( transition) | NA | 57µM |
| FMDB840 | 21985248 | NA | NA | VPP | VPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ gliadin,HMWglutein subunit, γ hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus plantarum FUA 3002 | peptidase+fungal protease | LCMS/MS | 312 - 213 ( transition) | NA | 5µM |
| FMDB841 | 21985248 | NA | NA | IPP | IPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | α-gliadin, ω-gliadin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus plantarum FUA 3002 | peptidase+fungal protease | LCMS/MS | 326 - 213 ( transition) | NA | 9µM |
| FMDB990 | NA | vallabha13 | Antihypertensive Peptides Derived from soy Protein by Fermentation | LIVTQ | LIVTQ | 5 | Fermented soy protein (Defatted soya flour) | NA | NA | 37C | 36h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus caseispp. pseudoplantarum | NA | RPHPLC and sequence determination by Edman degradatiojn usng Applied Biosystems 477-A gas phase sequencer | NA | NA | 0.087uM |
| FMDB991 | NA | Antihypertensive Peptides Derived from soy Protein by Fermentation | LIVT | LIVT | 4 | Fermented soy protein (Defatted soya flour) | NA | NA | 37C | 36h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus caseispp. pseudoplantarum | NA | RPHPLC and sequence determination by Edman degradatiojn usng Applied Biosystems 477-A gas phase sequencer | NA | NA | 0.11uM | |
| FMDB1074 | 27606488 | NA | NA | GPVRGPFP | GPVRGPFP | 8 | WSE of probiotic gouda cheese | β-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 826 | NA | NA |
| FMDB1077 | 27606488 | NA | NA | ARHPHPH | ARHPHPH | 7 | WSE of probiotic gouda cheese | k-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 851 | NA | NA |
| FMDB1079 | 27606488 | NA | NA | LPQYLKT | LPQYLKT | 7 | WSE of probiotic gouda cheese | αS2-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 862 | NA | NA |
| FMDB1081 | 27606488 | NA | NA | RPKHPIK | RPKHPIK | 7 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 875 | NA | NA |
| FMDB1084 | 27606488 | NA | NA | KPWIQPK | KPWIQPK | 7 | WSE of probiotic gouda cheese | αS2-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 896 | NA | NA |
| FMDB1087 | 27606488 | NA | NA | GPVRGPFPI | GPVRGPFPI | 9 | WSE of probiotic gouda cheese | β-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 939 | NA | NA |
| FMDB1092 | 27606488 | NA | NA | RPKHPIKH | RPKHPIKH | 8 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1012 | NA | NA |
| FMDB1094 | 27606488 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | WSE of probiotic gouda cheese | β-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1038 | NA | NA |
| FMDB1096 | 27606488 | NA | NA | VPSERYLGY | VPSERYLGY | 9 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1083 | NA | NA |
| FMDB1098 | 27606488 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1140 | NA | NA |
| FMDB1104 | 27606488 | NA | NA | EPVLGPVRGPFP | EPVLGPVRGPFP | 12 | WSE of probiotic gouda cheese | β-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1264 | NA | NA |
| FMDB1106 | 27606488 | NA | NA | HPIKHQGLPQE | HPIKHQGLPQE | 11 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1283 | NA | NA |
| FMDB1107 | 27606488 | NA | NA | YQEPVLGPVRGP | YQEPVLGPVRGP | 12 | WSE of probiotic gouda cheese | β-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1311 | NA | NA |
| FMDB1108 | 27606488 | NA | NA | QEPVLGPVRGPFP | QEPVLGPVRGPFP | 13 | WSE of probiotic gouda cheese | β-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1392 | NA | NA |
| FMDB1110 | 27606488 | NA | NA | RPKHPIKHQGLP | RPKHPIKHQGLP | 12 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1407 | NA | NA |
| FMDB1113 | 27606488 | NA | NA | RPKHPIKHQGLPQ | RPKHPIKHQGLPQ | 13 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1535 | NA | NA |
| FMDB1117 | 27606488 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1664 | NA | NA |
| FMDB1119 | 27606488 | NA | NA | RPKHPIKHQGLPQEV | RPKHPIKHQGLPQEV | 15 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1763 | NA | NA |
| FMDB1120 | 27606488 | NA | NA | RPKHPIKHQGLPQEVL | RPKHPIKHQGLPQEVL | 16 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct cultureLb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1876 | NA | NA |
| FMDB1122 | 27606488 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | WSE of probiotic gouda cheese | β-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct culture Lb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1880 | NA | NA |
| FMDB1125 | 27606488 | NA | NA | RPKHPIKHQGLPQEVLN | RPKHPIKHQGLPQEVLN | 17 | WSE of probiotic gouda cheese | αS1-Casein | NA | 15C | cheese ripening times 8 weeks | NA | NA | NA | NA | Lc. lactis subsp. cremoris, Leuconostoc, Lc. lactis subsp. lactis, and Lc. lactis subsp. lactis biovar diacetylactis+ adjunct cultureLb. plantarum H4 | NA | MALDI-TOF/MS/MS | 1990 | NA | NA |
| FMDB1921 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1922 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1934 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1935 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1936 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1937 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1950 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1951 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1952 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1953 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1964 | 22098174 | NA | NA | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 59 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1965 | 22098174 | NA | NA | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 40 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB2186 | 23642310 | NA | NA | TASSVASTTK | TASSVASTTK | 10 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum 1MR20, | NA | nano-LC-ESI-MS/ MS | NA | 952.217 da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2187 | 23642310 | NA | NA | TIKATKT | TIKATKT | 7 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum 1MR20, | NA | nano-LC-ESI-MS/ MS | NA | 762.272da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2188 | 23642310 | NA | NA | MLAAKSSAAST | MLAAKSSAAST | 11 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum 1MR20, | NA | nano-LC-ESI-MS/ MS | NA | 1037.511da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2189 | 23642310 | NA | NA | VSSGAEIAKI | VSSGAEIAKI | 10 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum 1MR20, | NA | nano-LC-ESI-MS/ MS | NA | 973.687da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2190 | 23642310 | NA | NA | NQMLAAKSSAAS | NQMLAAKSSAAS | 12 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum 1MR20, | NA | nano-LC-ESI-MS/ MS | NA | 1178.621da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2191 | 23642310 | NA | NA | VINIVLAAV | VINIVLAAV | 9 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum 1MR20, | NA | nano-LC-ESI-MS/ MS | NA | 911.725da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2192 | 23642310 | NA | NA | ENGNTLSG | ENGNTLSG | 8 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum 1MR20, | NA | nano-LC-ESI-MS/ MS | NA | 791.11da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2193 | 23642310 | NA | NA | GNMPSGG | GNMPSGG | 7 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum 1MR20, | NA | nano-LC-ESI-MS/ MS | NA | 612.36da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2194 | 23642310 | NA | NA | TASSVASTTK | TASSVASTTK | 10 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum C2 | NA | nano-LC-ESI-MS/ MS | NA | 952.217 da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2195 | 23642310 | NA | NA | TIKATKT | TIKATKT | 7 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum C2 | NA | nano-LC-ESI-MS/ MS | NA | 762.272da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2196 | 23642310 | NA | NA | MLAAKSSAAST | MLAAKSSAAST | 11 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum C2 | NA | nano-LC-ESI-MS/ MS | NA | 1037.511da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2197 | 23642310 | NA | NA | VSSGAEIAKI | VSSGAEIAKI | 10 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum C2 | NA | nano-LC-ESI-MS/ MS | NA | 973.687da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2198 | 23642310 | NA | NA | NQMLAAKSSAAS | NQMLAAKSSAAS | 12 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum C2 | NA | nano-LC-ESI-MS/ MS | NA | 1178.621da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2199 | 23642310 | NA | NA | VINIVLAAV | VINIVLAAV | 9 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum C2 | NA | nano-LC-ESI-MS/ MS | NA | 911.725da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2200 | 23642310 | NA | NA | ENGNTLSG | ENGNTLSG | 8 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum C2 | NA | nano-LC-ESI-MS/ MS | NA | 791.11da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2201 | 23642310 | NA | NA | GNMPSGG | GNMPSGG | 7 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum C2 | NA | nano-LC-ESI-MS/ MS | NA | 612.36da | (MIC )1.4 ± 0.2 mg/ml of peptides. |