| 1100 | Recombinant Soluble HIV-I GP41 (539-684) | VQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKL | 146 | L | None | None | None | Linear | Protein Derived | HIV-l (derived from clone BH10) | mitogen (Con A, PHA) | Inhibits mitogen-(Con A and PHA) and antigen-(tetanus toxaid)-induced lymphocyte proliferation. It also inhibits the spontaneous cell proliferation of human T, B and monocytic cell lines. | In vitro | Human H9, Jurkat, Raji, Daudi. U937 and HEF cell lines | 8micromolar | NA | BrdU-Labeling and Detection-Kit | NA | NA | 8847089 | 1995 |
| 1104 | HIV-1 soluble gp41 (sgp41) (539-684) | VQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKI | 146 | L | None | None | None | Linear | Protein Derived | HIV-1 isolate IIIB | NA | Enhances MHC class I expression | In vitro | Human H9, Jurkat, Raji, Daudi. U937 and HEF cell lines | NA | NA | NA | NA | NA | 9373217 | 1997 |
| 1141 | Glycodelin-A | MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF | 180 | L | None | None | None | Linear | Protein Derived | NA | IL-2 | Glycodelin-A interrupts the production of interleukin-2 (IL-2) by lymphocytes and inhibits the IL-2 activation of natural killer cells | In vitro | Cervical tissue | NA | NA | NA | NA | NA | 11063647 | 2000 |
| 1200 | LWX-AD-1 | NEAVPTGGCPFSDFFCAKRCKDMKFGNTGRCTGPNKTVCKCSI | 43 | L | None | None | None | Linear | Natural | Scorpion venom | Kv1.3 potassium channels of T cells | high specificity binding Kv1.3 potassium channels of T cells | Both | C0S-7 cells | 0.52 nM | Arthritic Lewis rats, EAE model of Wistar rats | NA | NA | NA | CN 101423550 B | 2012 |
| 1311 | None | CVCVCLLPRYPSAGVFTYLNTKIITFDSVLSKCA | 41 | L | None | None | None | Linear | Synthetic | Native nucloetide sequence capable of expressing GIF activity | Tissue harboring the parasite | Inhibit glycosylation inhibiting factors, which inhibits IgE production | Both | Spleen cells | NA | BALB/c | Hummoral Immune Response assay | NA | NA | US 4749685 | 1988 |
| 1549 | GAD-500-585 | QHTNVCFWFVPPSLRVLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLEEIERLGQDL | 85 | L | None | None | None | Linear | Synthetic | E.coli BL-21 | Effector T cells | Inctreased production of IL-4, IL-10, TGF- beta and IFN-gamma cells | in vivo | None | NA | NOD mice | ELISA, ELISPOT Assay | NA | Adeno Associated Virus | 15814672 | 2005 |
