| 1011 | OSK1 (α-KTx3.7) | GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge C1-C4, C2-C5 and C3-C6) | Linear | Natural | Venom of the central Asian scorpion Orthochirus scrobiculosus | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.60±0.04 nM for Kv1.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 2.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1012 | OSK1 (α-KTx3.7) | GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1C4, C2-C5 and C3-C6) | Linear | Natural | Venom of the central Asian scorpion Orthochirus scrobiculosus | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 5.40±1.89 nM for Kv1.2 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 2.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1013 | OSK1 (α-KTx3.7) | GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C-C4, C2-C5 and C3-C6) | Linear | Natural | Venom of the central Asian scorpion Orthochirus scrobiculosus | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.014±0.001 nM for Kv1.3 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 2.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1014 | OSK1 (α-KTx3.7) | GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge C1-C4, C2-C5 and C3-C6) | Linear | Natural | Venom of the central Asian scorpion Orthochirus scrobiculosus | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 225±10 nM for Kca 3.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 2.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1015 | [K16 ,D20 ]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.40± 0.01 nM for Kv1.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 2.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1016 | [K16 ,D20 ]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 2.96±0.01 nM for Kv1.2 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 2.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1017 | [K16 ,D20 ]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.003± 0.0011 nM for Kv1.3 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 2.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1018 | [K16 ,D20 ]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 228±92 nM for Kca 3.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 2.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1019 | [K16 ]-OSK1 | GVIINVKCKISRQCLKPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.63±0.05 nM for Kv1.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 3 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1020 | [K16 ]-OSK1 | GVIINVKCKISRQCLKPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 5.23±0.22 nM for Kv1.2 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 3 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1021 | [K16 ]-OSK1 | GVIINVKCKISRQCLKPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.067±0.006 nM for Kv1.3 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 3 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1022 | [K16 ]-OSK1 | GVIINVKCKISRQCLKPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 151±21 nM for Kca 3.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 3 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1023 | [D20 ]-OSK1 | GVIINVKCKISRQCLEPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 2.95±0.24 nM for Kv1.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 4.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1024 | [D20 ]-OSK1 | GVIINVKCKISRQCLEPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 77.8± 9.2 nM for Kv1.2 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 4.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1025 | [D20 ]-OSK1 | GVIINVKCKISRQCLEPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.037±0.007 nM for Kv1.3 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 4.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1026 | [D20 ]-OSK1 | GVIINVKCKISRQCLEPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 716±10 nM for Kca 3.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 4.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1027 | [P12 ,K16 , D20]-OSK1 | GVIINVKCKISPQCLKPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 3.18± 0.11 nM for Kv1.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 7.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1028 | [P12 ,K16 , D20]-OSK1 | GVIINVKCKISPQCLKPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 196±9 nM for Kv1.2 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 7.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1029 | [P12 ,K16 , D20]-OSK1 | GVIINVKCKISPQCLKPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.059±0.003 nM for Kv1.3 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 7.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1030 | [P12 ,K16 , D20]-OSK1 | GVIINVKCKISPQCLKPCKDAGMRFGKCMNGKCHCTPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2 and Kv 1.3 channel and also Ca2+ -activated KCa 3.1 channel | Potent blocker of three different Kv channel types and a moderate blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 2600±400 nM for Kca 3.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 7.5 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1031 | [K16,D20,Y36]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCYPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2, Kv 1.3 and Kv 1.7 channel and also Ca2+ -activated KCa 3.1 channel | Blocker of four different Kv channel types and also blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 34.4±0.3 nM for Kv1.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 9 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1032 | [K16,D20,Y36]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCYPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2, Kv 1.3 and Kv 1.7 channel and also Ca2+ -activated KCa 3.1 channel | Blocker of four different Kv channel types and also blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 232±11 nM for Kv1.2 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 9 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1033 | [K16,D20,Y36]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCYPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2, Kv 1.3 and Kv 1.7 channel and also Ca2+ -activated KCa 3.1 channel | Blocker of four different Kv channel types and also blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 0.122± 0.007 nM for Kv1.3 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 9 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1034 | [K16,D20,Y36]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCYPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2, Kv 1.3 and Kv 1.7 channel and also Ca2+ -activated KCa 3.1 channel | Blocker of four different Kv channel types and also blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 1500±500 nM for Kv1.7 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 9 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1035 | [K16,D20,Y36]-OSK1 | GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCYPK | 38 | L | None | None | Three- Disulphide-bridge (C1-C4, C2-C5 and C3-C6) | Linear | Synthetic | NA | Kv 1.1, Kv 1.2, Kv 1.3 and Kv 1.7 channel and also Ca2+ -activated KCa 3.1 channel | Blocker of four different Kv channel types and also blocker of Ca2+ -activated KCa 3.1 channel | Both | L929 and MEL (murine erythroleukaemia), COS-7 cells, tsA cell line, LTK-cells (lacking leucocyte tyrosine kinase), CHL (Chinese-hamster lung) cells, HEK-293 (human embryonic kidney) cells | 885±18 nM for Kca 3.1 | C57/BL6 mice | Neurotoxicity of peptide, Pharmacological activity on various K+ (Potassium) channel | 9 (μg/kg of mice) | NA | 15588251 | 2005 |
| 1060 | Margatoxin | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | None | Linear | Natural | From venom of the new world scorpion Centruroides margaritatus | Kv1.3 channels | Blocks with high affinity and specificity the Kv1.3 channel | In vitro | Human peripheral T-Lymphocytes, rat brain synaptic plasma membrane vesicles, bovine aortic sarcolemmal membrane vesicle | 36 pM | NA | competition binding with Kv1.3 (Potassium channel) | NA | NA | 8360176 | 1993 |
| 1061 | Charybdotoxin (ChTX) | EFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS | 37 | L | None | None | None | Linear | Natural | Isolated from venom of the old world scorpion Leiurusguinqwstriutus var. hebraeus | Kv1.3 channels | Inhibit high conductance, Ca2+- activated K+ (Maxi-K) channel | In vitro | Human peripheral T-Lymphocytes, rat brain synaptic plasma membrane vesicles, bovine aortic sarcolemmal membrane vesicle | NA | NA | competition binding with Kv1.4 ((Potassium channel) | NA | NA | 8360176 | 1993 |
