| 1001 | Vm24 | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC | 36 | L | None | Amidation | Cross linked by eight cysteines (between Cys6 and Cys26, Cys12 and Cys31, Cys16 and Cys33, and Cys21 and Cys36) (Disulphide linkage) | Linear | Natural | Venom of the Mexican scorpion Vaejovis mexicanus smithi | Block Kv1.3 channels with high affinity, an estimated Kd of 2.9 pM | Inhibits T Cell Proliferation, CD25 Expression, and Ca2+ Signaling In Vitro and Suppresses DTH Reactions In Vivo | Both | Human peripheral T Cells, COS-7, human embryonic kidney 293, tsA201, L929, and MEL cells | NA | Female Lewis rats (9-10 weeks of age) | T cell Proliferation assays | NA | NA | 22622363 | 2012 |
| 1051 | Vm24 | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC | 36 | L | None | Amidation | Four Disulfide bridges (between Cys6 and Cys26, Cys12 and Cys31, Cys16 and Cys33, and Cys21 and Cys36) | Linear | Natural | venom of the Mexican scorpion Vaejovis mexicanus smithi | K+ channel | Remarkable blocking potency and selectivity for Kv1.3 channels | Both | Mononuclear cells from human peripheral venous blood | 90% inhibition achieved at 100pM | Mouse model | Lethality test | No toxicity for 50 to 200 μg of protein per mouse (20 g body weight) | NA | 22540187 | 2012 |
| 1110 | H17 | LQNRRGLDLLTAEKGGL | 17 | L | None | Amidation | None | Linear | Protein Derived | Human endogenous retroviruses HERV-H/env60 (HERV-H) | NA | Induces CCL19 production in tumor cells, promotion of both CD271+ cell-governing immunosuppression and tumor invasion via the Twist-PI3K pathway. | Both | Colon cancer Colo320 and HCT116,pancreatic cancer MIAPaca and Panc1,melanoma Hs294T, andnormal epithelial cell ARPE19 | NA | Female BALB/c nu/nu mice | WST1 assay | NA | NA | 24590808 | 2014 |
| 1142 | RDP1258 | RNleNleNleRNleNleNleGY | 22 | L | None | Amidation | None | Linear | Protein Derived | NA | TNF-α | Enhanced expression of splenic heme oxygenase 1 (HO-1). Decreased expression of tumor necrosis factor a (TNF-α) mRNA; and an increased level of inducible nitric oxide synthase (iNOS) mRNA. | In vivo | NA | 20 micromolar | Eight- to 12-week-old male Lewis.lW (RTI.u) and Lewis.lA (RTI.')rats | Graft transplation assay | NA | NA | 10666482 | 2000 |
| 1358 | Formula 20 | KHL | 3 | L | None | Amidation | None | Linear | Synthetic | NA | Suppress the antigen presentation of macrophages or antigen recognition of T-cells in the immune processes | Inhibit maturation of the T-cell dependent antibody producing cells, supress the phagocytosis and dminish the late hypersensitive response | In vitro | Splenocyte s obtained from rats | NA | Twelve Wistar (LATI) rats | Hummoral Immune Response assay | NA | NA | US 5093320 | 1992 |
| 1438 | SEQ ID10 | rlllrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1439 | SEQ ID11 | rvllrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1440 | SEQ ID12 | rillrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1441 | SEQ ID13 | rlvlrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1442 | SEQ ID14 | rlilrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1443 | SEQ ID15 | rllvrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1444 | SEQ ID16 | rllirlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1445 | SEQ ID17 | rlllrvllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1446 | SEQ ID18 | rlllrillgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1447 | SEQ ID19 | rlllrlvlgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1448 | SEQ ID20 | rlllrlilgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1449 | SEQ ID21 | rlllrllvgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1450 | SEQ ID22 | rlllrlligy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1451 | SEQ ID23 | rwllrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1452 | SEQ ID24 | rlwlrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1453 | SEQ ID25 | rllwrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1454 | SEQ ID26 | rlllrwllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1455 | SEQ ID27 | rlllrlwlgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1456 | SEQ ID28 | rlllrllwgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1457 | SEQ ID29 | ryllrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1458 | SEQ ID30 | rlylrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1459 | SEQ ID31 | rllyrlllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1460 | SEQ ID32 | rlllryllgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1461 | SEQ ID33 | rlllrlylgy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1462 | SEQ ID34 | rlllrllygy | 10 | D | Acetylation | Amidation | None | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1463 | SEQ ID35 | R-nL-nL-nL-R-nL-nL-nLGY | 10 | L | Acetylation | Amidation | nL = norleucine | Linear | Protein Derived | (HLA-B) α1-domain | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | Both | RAW264.7 macrophages cells | NA | CBA mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 6696545 B1 | 2004 |
| 1495 | SEQ ID15 | rlllrlllGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC70 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1496 | SEQ ID16 | rvllrlllGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC71 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1497 | SEQ ID17 | rillrlllGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC72 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1498 | SEQ ID18 | rlvlrlllGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC73 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1499 | SEQ ID19 | rlilrlllGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC74 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1500 | SEQ ID20 | rllvrlllGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC75 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1501 | SEQ ID21 | rllirlllGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC76 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1502 | SEQ ID22 | rlllrvllGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC77 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1503 | SEQ ID23 | rlllrillGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC78 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1504 | SEQ ID24 | rlllrlvlGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC79 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1505 | SEQ ID25 | rlllrlilGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC80 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1506 | SEQ ID26 | rlllrllvGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC81 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1507 | SEQ ID27 | rlllrlliGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC82 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1508 | SEQ ID28 | rwllrlllGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC83 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1509 | SEQ ID29 | rlwlrlllGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC84 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1510 | SEQ ID30 | rllwrlllGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC85 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1511 | SEQ ID31 | rlllrwllGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC86 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1512 | SEQ ID32 | rlllrlwlGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC87 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
| 1513 | SEQ ID33 | rlllrllwGy | 10 | Mix | Acetylation | Amidation | None | Linear | Synthetic | NA | NA | Inhibited T-cell proliferation, various inflammatory cytokines production. | In vivo | None | 2.5-10micromolar against binding to peptides to HSC88 | C57BL6/J, Balb/c and CBA/J mice | Enzyme-linked immunosorbent assay (ELISA) | NA | LPS | US 7267822 B2 | 2007 |
