Browse result page of FermFooDB Database

This is the result page of browse. This page gives the information about peptides returned against the selected category. Further details of the peptide can be seen by clicking on the FMDB_ID. Further the user can sort the peptides on the basis of various fields by clicking on the respective headers.

The total number entries retrieved from this search are 85

FMDB_IDPubMed IDReferenceTitlePeptide_SequenceSequenceLength of peptideFood_Matrix Protein pHTemperatureIncubation TimeActivityExperimentModelAssay for Activity MeasurementCultureHydrolysisMethod of analysisM_Z ratioMassIC50
FMDB2310416158NANAYPYP2Yogurt like productαS1-Casein4.3NANAAce-inhibitoryIn vivoSpontaneously Hypertensive RatsNALactobacillus helveticus CPN4proteinaseNANA NA720uM
FMDB2410416158NANAYPYP2Yogurt like productβ-Casein4.3NANAAce-inhibitoryIn vivoSpontaneously Hypertensive RatsNALactobacillus helveticus CPN4proteinaseNANA NA720uM
FMDB2510416158NANAYPYP2Yogurt like productk-Casein4.3NANAAce-inhibitoryIn vivoSpontaneously Hypertensive RatsNALactobacillus helveticus CPN4proteinaseNANA NA720uM
FMDB780NApapdimitriou07Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activityDKIHPFAQDKIHPFAQ8sheep Milk Yogurtβ-Casein4.742C4hAce-inhibitoryIn vitroNAACE In hibitory activity using HHL as the substrateL. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412proteinaseRPHPLC and automated, pulsed liquid-phase protein-peptide sequencerNA NA257uM
FMDB781NAIdentification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activityTQTPVVVPTQTPVVVP8sheep Milk Yogurtβ-Casein4.742C4hAce-inhibitoryIn vitroNAACE In hibitory activity using HHL as the substrateL. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412proteinaseRPHPLC and automated, pulsed liquid-phase protein-peptide sequencerNA NA173uM
FMDB784NAIdentification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activityRPKHPIKHRPKHPIKH8sheep Milk YogurtαS1-Casein4.742C4hAce-inhibitoryIn vitroNAACE In hibitory activity using HHL as the substrateL. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412proteinaseRPHPLC and automated, pulsed liquid-phase protein-peptide sequencerNA NA40.3uM
FMDB785NAIdentification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activitySQPK YQEPSQPK YQEP9sheep Milk Yogurtβ-Casein4.742C4hAce-inhibitoryIn vitroNAACE In hibitory activity using HHL as the substrateL. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412proteinaseRPHPLC and automated, pulsed liquid-phase protein-peptide sequencerNA NANA
FMDB786NAIdentification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activityNQFLPYPYNQFLPYPY8sheep Milk Yogurtk-Casein4.742C4hAce-inhibitoryIn vitroNAACE In hibitory activity using HHL as the substrateL. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412proteinaseRPHPLC and automated, pulsed liquid-phase protein-peptide sequencerNA NANA
FMDB787NAIdentification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activityTQTPVVVPTQTPVVVP8sheep Milk Yogurtβ-Casein4.742C4hAce-inhibitoryIn vitroNAACE In hibitory activity using HHL as the substrateL. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412proteinaseRPHPLC and automated, pulsed liquid-phase protein-peptide sequencerNA NANA
FMDB788NAIdentification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activityYPVEPFTEYPVEPFTE8sheep Milk Yogurtβ-Casein4.742C4hAce-inhibitoryIn vitroNAACE In hibitory activity using HHL as the substrateL. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412proteinaseRPHPLC and automated, pulsed liquid-phase protein-peptide sequencerNA NA0.37mg/ml
FMDB79225829629NANATYKEETYKEE5skim Milk YogurtαS2-Casein4.542C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others12hAce-inhibitoryIn vitroNAspectrophotometric assay using HHL as substrateL. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B94proteinase and peptidaseRPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencerNA NA12.41+/-0.46ug/ml
FMDB79325829629NANAIPPIPP3skim Milk Yogurtβ-Casein4.542C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others12hAce-inhibitoryIn vitroNAspectrophotometric assay using HHL as substrateL. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B95proteinase and peptidaseRPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencerNA NA11.6uM
FMDB79425829629NANAIPPIPP3skim Milk Yogurtk-Casein4.542C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others12hAce-inhibitoryIn vitroNAspectrophotometric assay using HHL as substrateL. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B96proteinase and peptidaseRPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencerNA NA11.6uM
FMDB79525829629NANAYQQPVLYQQPVL6skim Milk Yogurtβ-Casein4.542C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others12hAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substateL. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B96proteinase and peptidaseRPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencerNA NA6.09+/-0.46ug/ml
FMDB79625829629NANARINKKRINKK5skim Milk Yogurtβ-Casein4.542C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others12hAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substateL. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B97proteinase and peptidaseRPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencerNA NA12.05+/-0.93ug/ml
FMDB79725829629NANASLPQNSLPQN5skim Milk Yogurtβ-Casein4.542C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others12hAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substateL. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B98proteinase and peptidaseRPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencerNA NA5.29±0.55ug/ml
FMDB79825829629NANAVPPVPP3skim Milk Yogurtβ-Casein4.542C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others12hAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substateL. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B99proteinase and peptidaseRPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencerNA NA8.4uM
FMDB79925829629NANAARHPHARHPH5skim Milk Yogurtk-Casein4.542C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others12hAce-inhibitoryIn vitroNASpectrophotometric assay using HHL as substateL. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B100proteinase and peptidaseRPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencerNA NA9.64±3.67ug/ml
FMDB1283NAkajimoto02Hypotensive effects of tablets containing “lactotripeptides (VPP, IPP)”IPPIPP3Yogurtβ-CaseinNANANAAnti-hypertensiveIn vivoSpontaneously Hypertensive RatsNAL. helveticus and S. cerevisiaeProteinaseNANA NA5 micro mol /l
FMDB1284NAkajimoto02Hypotensive effects of tablets containing “lactotripeptides (VPP, IPP)”IPPIPP3Yogurtk-CaseinNANANAAnti-hypertensiveIn vivoSpontaneously Hypertensive RatsNAL. helveticus and S. cerevisiaeProteinaseNANA NA5 micro mol /l
FMDB1285NAkajimoto02Hypotensive effects of tablets containing “lactotripeptides (VPP, IPP)”VPPVPP3Yogurtβ-CaseinNANANAAnti-hypertensiveIn vivoSpontaneously Hypertensive RatsNAL. helveticus and S. cerevisiaeProteinaseNANA NA9micromol/l
FMDB1292NAfarvin10Antioxidant activity of Yogurt peptides: Part 2 – Characterisation of peptide fractionsQQQTEDQQQTED6fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 748NA
FMDB1293NAfarvin10NANSKKTVDNSKKTVD7fish oil enriched YogurtαS2-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 791.4NA
FMDB1294NAfarvin10NAYPYP2fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 279NA
FMDB1295NAfarvin10NAYAKPAYAKPA5fish oil enriched Yogurtk-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 549.2NA
FMDB1296NAfarvin10NATVQVTTVQVT5fish oil enriched Yogurtk-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 547.2NA
FMDB1297NAfarvin10NATVQVTSTTVQVTST7fish oil enriched Yogurtk-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 735.4NA
FMDB1298NAfarvin10NAVPYPQVPYPQ5fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 603.3NA
FMDB1299NAfarvin10NAPIGSENSPIGSENS7fish oil enriched YogurtαS1-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 703.4NA
FMDB1300NAfarvin10NAKAVPYPQKAVPYPQ7fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 802.5NA
FMDB1301NAfarvin10NATVQVTSTAVTVQVTSTAV9fish oil enriched Yogurtk-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 905.5NA
FMDB1302NAfarvin10NAIESPPEINIESPPEIN8fish oil enriched Yogurtk-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 898.3NA
FMDB1303NAfarvin10NANVPGEIVENVPGEIVE8fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 856.4NA
FMDB1304NAfarvin10NAVIESPPEINVIESPPEIN9fish oil enriched Yogurtk-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 997.6NA
FMDB1305NAfarvin10NAKVLPVPEKVLPVPE7fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 780.6NA
FMDB1306NAfarvin10NAGVRGPFPIIGVRGPFPII9fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 996.3NA
FMDB1307NAfarvin10NADKIHPFDKIHPF6fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 756.3NA
FMDB1308NAfarvin10NAIPIQYIPIQY5fish oil enriched Yogurtk-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 633.3NA
FMDB1309NAfarvin10NAVFGKEKVNELVFGKEKVNEL10fish oil enriched YogurtαS1-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 1162.7NA
FMDB1310NAfarvin10NAELQDKIHPFELQDKIHPF9fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 1126.6NA
FMDB1311NAfarvin10NAYPFPGPIPNYPFPGPIPN9fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 1001.6NA
FMDB1312NAfarvin10NAQQPVLGPVRGPFPQQPVLGPVRGPFP13fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 1392.9NA
FMDB1313NAfarvin10NAHKEMPFPKYPVQPFHKEMPFPKYPVQPF14fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 1746.9NA
FMDB1314NAfarvin10NAMAPKHKEMPFPKYPVQPFMAPKHKEMPFPKYPVQPF18fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 2173.2NA
FMDB1315NAfarvin10NALVYPFPGPIPNLVYPFPGPIPN11fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 1213.6NA
FMDB1316NAfarvin10NASLVYPFPGPIPNSLVYPFPGPIPN12fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 1300.6NA
FMDB1317NAfarvin10NAMPFPKYPVQPFMPFPKYPVQPF11fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 1351.6NA
FMDB1318NAfarvin10NATQTPVVVPPFLQPETQTPVVVPPFLQPE14fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 1552.4NA
FMDB1319NAfarvin10NAYQQPVLGPVRGPFPIIYQQPVLGPVRGPFPII16fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 1782.1NA
FMDB1320NAfarvin10NARDMPIQAFLLRDMPIQAFLL10fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 1203.7NA
FMDB1321NAfarvin10NAQQPVLGPVRGPFPIIVQQPVLGPVRGPFPIIV16fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 1719NA
FMDB1322NAfarvin10NAYQQPVLGPVRGPFPIIVYQQPVLGPVRGPFPIIV17fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 1882.1NA
FMDB1323NAfarvin10NAMAPKHEMPFPKYPMAPKHEMPFPKYP13fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 1701.5NA
FMDB1324NAfarvin10NASLPQNIPPLTQTPVVVPFLQPEVMSLPQNIPPLTQTPVVVPFLQPEVM24fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 2742.2NA
FMDB1325NAfarvin10NANIPPLTQTPVVVPFLQPEVMNIPPLTQTPVVVPFLQPEVM20fish oil enriched Yogurtβ-CaseinNANANAAntioxidantIn vitroNAAssay by DPPH radicalscavengingNANALC-MS/MSNA 2317.2NA
FMDB2122NAschieber00Characterization of oligo- and polypeptides isolated from YogurtFAQFAQ3Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 364.4g/molNA
FMDB2123NAschieber00Characterization of oligo- and polypeptides isolated from YogurtKFQSEEKFQSEE6Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 846.8g/molNA
FMDB2124NAschieber00Characterization of oligo- and polypeptides isolated from YogurtQQQTEDELQQQQTEDELQ9Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 1118.1g/molNA
FMDB2125NAschieber00Characterization of oligo- and polypeptides isolated from YogurtKAVPYPQKAVPYPQ7Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptide802.3 +1 802.g/molNA
FMDB2126NAschieber00Characterization of oligo- and polypeptides isolated from YogurtSPPEINSPPEIN6Yogurtk-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 655.7g/molNA
FMDB2127NAschieber00Characterization of oligo- and polypeptides isolated from YogurtLIHPFAQLIHPFAQ7Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 840g/molNA
FMDB2128NAschieber00Characterization of oligo- and polypeptides isolated from YogurtDKIHPFAQTQDKIHPFAQTQ10Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptide593.2+2 1184.3 g/molNA
FMDB2129NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatKAVPYPQRDMPIQKAVPYPQRDMPIQ13Yogurtβ-Casein4.944c3hAce-inhibitoryNANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 1541.8g/molNA
FMDB2130NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatSQSKVLPVPQSQSKVLPVPQ10Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptide541.7+2 1082.3 g/molNA
FMDB2131NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatAVPYPQRDMPIAVPYPQRDMPI11Yogurtβ-Casein4.944c3hAce-inhibitoryNANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 1285.5g/molNA
FMDB2132NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatDKIHPFDKIHPF6Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptide756.8+1 755.9 g/molNA
FMDB2133NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatSVLSLSQSVLSLSQ7Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 732.8g/molNA
FMDB2134NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatSVLSLSSVLSLS6Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 604.7g/molNA
FMDB2135NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatYQEPVLYQEPVL6Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptide748.3+1 747.9g/molNA
FMDB2136NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatLTLTDVELTLTDVE7Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 789.9g/molNA
FMDB2137NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatDMPIQAFDMPIQAF7Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 821g/molNA
FMDB2138NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatSLTLTDVESLTLTDVE8Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 877g/molNA
FMDB2139NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatLNVPGEIVQLNVPGEIVQ9Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 969.1g/molNA
FMDB2140NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatFVAPFPEFVAPFPE7YogurtαS1-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 805.9g/molNA
FMDB2141NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatFLLFLL3Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 391.5g/molNA
FMDB2142NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatSLVYPFPGPIHNSLVYPFPGPIHN12Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 1340.6g/molNA
FMDB2143NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatDMPIQAFLDMPIQAFL8Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 934.1g/molNA
FMDB2144NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatSLVYPFPGPIHNSLPQSLVYPFPGPIHNSLPQ16Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptide884.4+2 1766.1 g/molNA
FMDB2145NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatVAPFPEVFVAPFPEVF8YogurtαS1-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 905.1g/molNA
FMDB2146NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatGPVRGPFGPVRGPF7Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 727.9g/molNA
FMDB2147NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatFVAPFPEVFGFVAPFPEVFG10YogurtαS1-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 1109.3g/molNA
FMDB2148NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatYYEQPVLGPVRGPFPIIVYYEQPVLGPVRGPFPIIV18Yogurtβ-Casein4.944c3hAce-inhibitoryNANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptide941.3+2 1880.3 g/molNA
FMDB2149NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatLYQEPVLGPVRGPFLYQEPVLGPVRGPF14Yogurtβ-Casein4.944c3hAce-inhibitoryNANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 1570.9g/molNA
FMDB2150NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatLLYQEPVLGPVRGPFLLYQEPVLGPVRGPF15Yogurtβ-Casein4.944c3hAce-inhibitoryNANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 1684g/molNA
FMDB2151NAschieber00Angiotensin I-Converting EnzymeInhibitor Derived from an Enzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of RatNLHLPLPLPLLQNLHLPLPLPLLQ12Yogurtβ-Casein4.944c3hNANANANAStreptococcus salivarius ssp. thermophilus (S. thermophilus) and Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricusNAHPLC and A Pulsed-liquid Sequencer ESI-MS for selected peptideNA 1157.4g/molNA