ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
---|---|---|---|---|---|---|---|---|---|---|---|---|
2073 | KFFKFFKFFK | CPP-PNA | 10 | L | Linear | Synthetic | NA | Free | Conjugation with nucleic acid | Nucleic acid is attached via an ethylene glyol linker | PNA | 23305655 |
2074 | KFFKFFKFFK | CPP-PNA | 10 | L | Linear | Synthetic | NA | Free | Conjugation with nucleic acid | Nucleic acid is attached via an ethylene glyol linker | PNA | 23305655 |
2075 | KFFKFFKFFK | CPP-PNA | 10 | L | Linear | Synthetic | NA | Free | Conjugation with nucleic acid | Nucleic acid is attached via an ethylene glyol linker | PNA | 23305655 |
2076 | KFFKFFKFFK | CPP-PNA | 10 | L | Linear | Synthetic | NA | Free | Conjugation with nucleic acid | Nucleic acid is attached via an ethylene glyol linker | PNA | 23305655 |
2077 | KFFKFFKFFK | CPP-PNA | 10 | L | Linear | Synthetic | NA | Free | Conjugation with nucleic acid | Nucleic acid is attached via an ethylene glyol linker | PNA | 23305655 |
2078 | KFFKFFKFFK | CPP-PNA | 10 | L | Linear | Synthetic | NA | Free | Conjugation with nucleic acid | Nucleic acid is attached via an ethylene glyol linker | PNA | 23305655 |
2079 | KFFKFFKFFK | CPP-PNA | 10 | L | Linear | Synthetic | NA | Free | Conjugation with nucleic acid | Nucleic acid is attached via an ethylene glyol linker | PNA | 23305655 |
2080 | KFFKFFKFFK | CPP-PNA | 10 | L | Linear | Synthetic | NA | Free | Conjugation with nucleic acid | Nucleic acid is attached via an ethylene glyol linker | PNA | 23305655 |
2081 | CRGDKGPDC | iRGD-CDD | 9 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (Red fluorophor Dy550) | 23248118 |
2082 | ARRRAARAARRRAARAARRRAARAARRRAARA | 32 A-R | 32 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
2083 | AKKKAAKAAKKKAAKAAKKKAAKAAKKKAAKA | 32 A-K | 32 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
2084 | ARRRAARAARRRAARAARRRAARA | 24 A-R | 24 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
2085 | AKKKAAKAAKKKAAKAAKKKAAKA | 24 A-K | 24 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
2086 | ARRARAARRARAARRARAARRARAARRARA | 30 A-R | 30 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
2087 | AKKAKAAKKAKAAKKAKAAKKAKAAKKAKA | 30 A-K | 30 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
2088 | RARARARARARARARARARARARARARARARA | 32 RA | 32 | L | Linear | Synthetic | NA | Free | Free | NA | Nucleic acid (DNA labelled with FITC) | 23454086 |
2089 | YGRKKRRQRRR | 6His-TAT-Ainp1 | 11 | L | Linear | Protein derived | Cationic | Free | Free | Histidine tagged | Peptide (Ainp1) | 23454269 |
2090 | YGRKKRRQRRR | 6His-TAT-GFP | 11 | L | Linear | Protein derived | Cationic | Free | Free | Histidine tagged | Protein (eGFP) | 23454269 |
2091 | YGRKKRRQRRR | 6xHis-TAT-SOD | 11 | L | Linear | Protein derived | Cationic | Free | Free | Histidine tagged | Protein (Cu,Zn-superoxide dismutase) | 23289802 |
2092 | YTFGLKTSFNVQ | Ypep-GFP | 12 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP), Phage | 23521800 |
2093 | YTFGLKTSFNVQYTFGLKTSFNVQ | Ypep-GFP-Ypep | 24 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP), Phage | 23521800 |
2094 | YGRKKRRQRRR | Tat-GFP | 11 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP) | 23521800 |
2095 | YGRKKRRQRRRYGRKKRRQRRR | Tat-GFP-Tat | 22 | L | Linear | Protein derived | NA | Free | Free | NA | Protein (eGFP) | 23521800 |
2096 | RQIKIWFQNRRMKWKK | Pen-GFP | 16 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (eGFP) | 23521800 |
2097 | RQIKIWFQNRRMKWKKRQIKIWFQNRRMKWK | Pen-GFP-Pen | 31 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (eGFP) | 23521800 |
2098 | CRGDK | CRGDK | 5 | L | Linear | Synthetic | NA | Free | Free | NA | Small molecule drug (Doxorubicin), DSPE- PEG2000 | 23634882 |
2099 | GLFEAIEGFIENGWEGMIDGWYGGGGrrrrrrrrrK | Peptide 599 | 36 | Mix | Linear | Synthetic | NA | Free | Biotinylation | Biotinylation at lysine residue | Nucleic acid (siRNA) | 24019920 |
2102 | LSTAADMQGVVTDGMASGLDKDYLKPDD | p28 | 28 | L | Linear | Protein derived | Anionic | Free | Free | NA | NA | 23736031 |
2103 | LSTAADMQGVVTDGMASGLDKDYLKPDD | p28 | 28 | L | Linear | Protein derived | Anionic | Free | Free | NA | NA | 23952735 |
2121 | YGRKKRRQRRR | TAT | 11 | L | Linear | Protein derived | NA | Free | NA | NA | Small molecule drug (Doxorubicin and Paclitaxel) | 23792465 |
2122 | AGYLLGHINLHHLAHLHHILC | TH peptide | 21 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (Liposomes) | 23891517 |
2123 | AGYLLGHINLHHLAHLHHIL | TH peptide | 20 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Nanoparticle (Liposomes) | 23891517 |
2124 | AGYLLGKINLKKLAKLLLIL | TK peptide | 20 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Nanoparticle (Liposomes) | 23891517 |
2126 | RQIKIWFQNRRMKWKK | L-Penetratin | 16 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | Protein (Insulin) | 24060698 |
2127 | KWFKIQMQIRRWKNKR | PenetraMax | 16 | L | Linear | Synthetic | NA | Free | Free | NA | Protein (Insulin) | 24060698 |
2128 | TAMRAVDKLLLHLKKLFREGQFNRNFESIIICRDRT | IL-13p | 36 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (Coumarin-6 and DiR) | 24120853 |
2129 | YGRKKRRQRRR | TAT-gelonin | 11 | L | Linear | Protein derived | Cationic | Free | Free | NA | Protein (gelonin) | 25204286 |
2130 | RRRRRRRRRRR | poly-arginine | 11 | L | Linear | Synthetic | Cationic | Free | Conjugation with 6His-tag | NA | Protein (Oct-4 protein) | 25199543 |
2148 | CIGAVLKVLTTGLPALISWIKRKRQQ | Melittin | 26 | L | Linear | Protein derived | Amphipathic | Free | Free | NA | PNA | 25185512 |
2149 | AGYLLGKINLKALAALAKKILGGC | Transportan 10 | 24 | L | Linear | Chimeric | Amphipathic | Free | Free | Linker Di-Glycine | PNA | 25185512 |
2150 | GKKALKLAAKLLKKC | GKK peptide | 15 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | PNA | 25185512 |
2151 | RRRRRRRQIKILFQNRRMKWKKGGC | R6-Pen(W-L) | 25 | L | Linear | Protein derived | Cationic | Free | Free | Linker Di-Glycine | PNA | 25185512 |
2152 | GLFKALLKLLKSLWKLLLKAGGC | ppTG | 23 | L | Linear | Synthetic | NA | Free | Free | Linker Di-Glycine | PNA | 25185512 |
2153 | GALFLGWLGAAGSTMGAPKSKRKVGGC | MPG-NLS | 27 | L | Linear | Synthetic | NA | Free | Free | Linker Di-Glycine | PNA | 25185512 |
2154 | KWFETWFTEWPKKRKGGC | Pep-3 | 18 | L | Linear | Synthetic | NA | Free | Free | Linker Di-Glycine | PNA | 25185512 |
2155 | LIRLWSHLIHIWFQNRRLKWKKKGGC | EB-1 | 26 | L | Linear | Synthetic | Amphipathic | Free | Free | Linker Di-Glycine | PNA | 25185512 |
2156 | WEAKLAKALAKALAKHLAKALAKALKACEA | KALA | 30 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | PNA | 25185512 |
2157 | MVTVLFRRLRIRRACGPPRVRV | M918 | 22 | L | Linear | Synthetic | NA | Free | Free | NA | PNA | 25185512 |
2158 | CGGMVTVLFRRLRIRRASGPPRVRV | M918(C-S) | 25 | L | Linear | Synthetic | NA | Free | Amidation | NA | PNA | 25185512 |
2159 | MVTVLFKRLRIRRACGPPRVKV | M918(R-K) | 22 | L | Linear | Synthetic | NA | Free | Free | NA | PNA | 25185512 |