Browse result page of AntiTbPdb
The total number entries retrieved from this search are 87
ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
antitb_1132 | Human neutrophil defensin (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Internal disulphide bond (cys2-cys30, cys4-cys19,cys9-cys29) | Cyclic | 30 | L | Cationic | Protein Derived | From the human defensin protein found in granules of neutrophils. | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 25618) | 50 mg/L causes approx 70 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1133 | Human neutrophil defensin (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Internal disulphide bond (cys2-cys30, cys4-cys19,cys9-cys29) | Cyclic | 30 | L | Cationic | Protein Derived | From the human defensin protein found in granules of neutrophils. | Mycobacterium tuberculosis | Mycobacterium tuberculosis E1380/94 MDR (Isoniazid, rifampicin, streptomycin, ethambutol) strain | 50 mg/L causes approx 30 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1134 | Protegrin-1 (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Internal disulphide bond (between Cys 6-15 and Cys 8-13) | Cyclic | 18 | L | Cationic | Natural | Isolated from porcine leukocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 25618) | 50 mg/L causes approx 65 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1135 | Protegrin-1 (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Internal disulphide bond (between Cys 6-15 and Cys 8-13) | Cyclic | 18 | L | Cationic | Natural | Isolated from porcine leukocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis E1380/94 MDR (Isoniazid, rifampicin, streptomycin, ethambutol) strain | 50 mg/L causes approx 39 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1223 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-29 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 96.5 % inhibition at 10 μg/ml | In vitro | THP-1 cells | Significant reduction in CFU | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
antitb_1224 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-30 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 98.3 % inhibition at 15 μg/ml | In vitro | THP-1 cells | Significant reduction in CFU | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
antitb_1225 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-31 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium tuberculosis | 36 Clinical isolates of Mycobacterium tuberculosis | 11 isolates (31%) showed greater sensitivity to HNP-1 than H37Rv strains. At 15 μg/ml, they wer completely inhibited. | In vitro | THP-1 cells | Sixteen clinical isolates had lower intracellular growth ability than the H37Rv strain. | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
antitb_1226 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-32 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium bovis | Mycobacterium bovis BCG | 99.6 % inhibition at 10 μg/ml | In vitro | THP-1 cells | Significant reduction in CFU | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
antitb_1227 | Human neutrophil peptide 1 (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulfide bridge: 2-30, 4-19, 9-33 | Cyclic | 30 | L | NA | Protein Derived | Human neutrophil | Mycobacterium bovis | Mycobacterium bovis BCG | 100 % inhibition at 10 μg/ml | In vitro | THP-1 cells | Significant reduction in CFU | NA | None | NA | NA | NA | NA | None | None | 2013 | 23827033 |
antitb_1256 | Eosinophil Cationic Protein (RNase 3) | RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNN | Free | Free | Disulphide linkage | Cyclic | 70 | L | Cationic | Natural | Secreted by eosinophil secondary granules | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 20.0 ± 1.0 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1257 | Eosinophil Cationic Protein (RNase 3) | RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNN | Free | Free | Disulphide linkage | Cyclic | 70 | L | Cationic | Natural | Secreted by eosinophil secondary granules | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 11.6 ± 0.2 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1258 | RNase 7 | KPKGMTSSQWFKIQHMOPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKN | Free | Free | Disulphide linkage | Cyclic | 68 | L | Cationic | Natural | Secreted by innate cells during host defense | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 20.0 ± 0.5 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1259 | RNase 7 | KPKGMTSSQWFKIQHMOPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKN | Free | Free | Disulphide linkage | Cyclic | 68 | L | Cationic | Natural | Secreted by innate cells during host defense | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 9.3 ± 1.2 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
antitb_1345 | Tenecin 1 fragment 17-27 | DAACAAHCLFR | Free | Amidation | Internal disulphide bond | Cyclic | 11 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 608 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | None | 1998 | 9693108 |
antitb_1349 | Tenecin 1 Fragment 33-43 | YCNGKRVCVC | Free | Amidation | Internal disulphide bond | Cyclic | 10 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 612 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | Antibacterial against MRSA, bacillus subtilis, E.coli, Shigella at 10-30 μg/ml | 1998 | 9693108 |
antitb_1355 | NKLF1 | VTQAASRVCDKMKILRGVCKKIMRTFLRR | Free | Free | Internal disulphide bond at residue between 9-13 | Cyclic | 29 | L | NA | Natural | Pig cytolytic lymphocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 25619 | IC90 = 30 μM | In vitro | Human erythroleukaemia cell line K562 | NA | 31 % cytolytic activity in range of 3 -7 μM peptide concentration | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus | 1999 | 10585872 |
antitb_1357 | Gran F2 | VCRTGRSRWRDVCRNFMRRYQSR | Free | Free | Internal disulphide bond at residue between 2-13 | Cyclic | 23 | L | NA | Natural | Human cytolytic lymphocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 25621 | IC90 = 30 μM | In vitro | Human erythroleukaemia cell line K562 | NA | 33 % cytolytic activity in range of 3 -7 μM peptide concentration | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus | 1999 | 10585872 |
antitb_1370 | Human neutrophil peptides-1 | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | cyclic | 30 | L | Cationic | Synthetic | Human neutrophils | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37 Ra | NA | in vitro | None | NA | NA | NA | NA | NA | NA | Mycobacterial genomic DNA | NA | antibacterial against candida albicans | 2000 | 11375668 |
antitb_1388 | Hepcidin | DTHFPICIFCCGCCHRSKCGMCCKT | Free | Free | Disulphide linkage between cys7-23, cys10-13, cys11-19,cys14-22 | Cyclic | 25 | L | Cationic | Natural | Human alveolar type 2 epithilium | Mycobacterium tuberculosis | Mycobacterium H37Rv | NA | in vivo | A549 cell line | NA | No cytotoxicity | BALB/C | NA | Increased production of TNF-α, IL-1α | NA | Mycobacterium tuberculosis + IFN-Υ | antimicrobial | 2011 | 21482189 | |
antitb_1527 | Human neutrohil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | cyclic | 30 | L | Cationic | Synthetic | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | Inteacting with microbial membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
antitb_1535 | Human neutrohil peptide (HNP-1) | DCYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 2.5 μg/ml | in vitro | NA | NA | No cytotoxicity | NA | NA | Mediate macrophage to induce TNF-α expression | Inhibit lipid biosynthesi | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25613372 |
antitb_1536 | Human neutrohil peptide (HNP-1) | DCYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | IC50=0.0375 μg/ml | in vitro | NA | NA | NA | NA | NA | Mediate macrophage to induce TNF-α expression | Inhibit lipid biosynthesi | NA | HNP-1 + Rifampicin | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25613372 |
antitb_1537 | Human neutrohil peptide (HNP-1) | DCYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | IC50= 0.0255 μg/ml | in vitro | NA | NA | NA | NA | NA | Mediate macrophage to induce TNF-α expression | Inhibit lipid biosynthesi | NA | HNP-1 + Isoniazid | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25613372 |
antitb_1563 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.20 ± 0.15 at peptide concentration 64μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1564 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.70 ± 0.15 at peptide concentration 64μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1565 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 0.88± 0.30 at peptide concentration 4 μg/ml +INH 0.06 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | INH +peptide | NA | 2004 | 15245864 |
antitb_1566 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.19 ± 0.15 at peptide concentration 64 μg/ml +INH 0.06 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | INH+Peptide | NA | 2004 | 15245864 |
antitb_1567 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.19 ± 0.15 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1568 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.58 ± 0.47 at peptide concentration 8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1569 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.16 ± 0.21 at peptide concentration 16 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1570 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.97 ± 0.40 at peptide concentration 32 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1571 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.70 ± 0.10 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1572 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 1.72 ± 0.46 at peptide concentration 128 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1573 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 3.08 ± 0.09 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1574 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 19 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM23 | CFU/well 2.97 ± 0.06 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1575 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 20 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM24 | CFU/well 3.11 ± 0.09 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1576 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 21 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM25 | CFU/well 3.19 ± 0.05 at peptide concentration 4 μg/ml +INH 4μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1577 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 22 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM26 | CFU/well 3.08 ± 0.09 at peptide concentration 64 μg/ml +INH 4μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1578 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 3.10 ± 0.08 at peptide concentration 8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1579 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 3.00 ± 0.10 at peptide concentration 16 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1580 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 3.05 ± 0.11 at peptide concentration 32 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1581 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.88 ± 0.06at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1582 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.71 ± 0.09 at peptide concentration 128 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1583 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.11 ± 0.10 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1584 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.15 ± 0.0.16 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1585 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 1.31 ± 0.10 at peptide concentration 4 μg/ml + INH 0.06 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | peptide +INH | NA | 2004 | 15245864 |
antitb_1586 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | peptide +INH | NA | 2004 | 15245864 |
antitb_1587 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.15 ± 0.20 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1588 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.21 ± 0.42 at peptide concentration 8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1589 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.02 ± 0.30 at peptide concentration 16 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |