| Primary information |
|---|
| ID | antitb_1583 |
| Peptide Name | β-Defensin-1(HBD-1) |
| Sequence | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Linear/ Cyclic | Cyclic |
| Length | 36 |
| Chirality | L |
| Nature | Cationic |
| Source | Natural |
| Origin | Derived from beta defensin 1 OF HUMAN |
| Species | Mycobacterium tuberculosis |
| Strain | Mycobacterium tuberculosis H37Rv |
| Inhibition Concentartion | CFU/well 3.11 ± 0.10 at peptide concentration 4 μg/ml |
| In vitro/In vivo | in vitro |
| Cell Line | NA |
| Inhibition Concentartion | NA |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Response | NA |
| Mechanism of Action | Bacterial membrane pore formation |
| Target | NA |
| Combination Therapy | NA |
| Other Activities | NA |
| Pubmed ID | 15245864 |
| Year of Publication | 2004 |
| 3-D Structure | NA |