| Primary information |
|---|
| ID | antitb_1259 |
| Peptide Name | RNase 7 |
| Sequence | KPKGMTSSQWFKIQHMOPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKN |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | Disulphide linkage |
| Linear/ Cyclic | Cyclic |
| Length | 68 |
| Chirality | L |
| Nature | Cationic |
| Source | Natural |
| Origin | Secreted by innate cells during host defense |
| Species | Mycobacterium vaccae |
| Strain | Mycobacterium vaccae strain (ATCC 15483) |
| Inhibition Concentartion | IC50 = 9.3 ± 1.2 μM |
| In vitro/In vivo | In vitro |
| Cell Line | None |
| Inhibition Concentartion | NA |
| Cytotoxicity | NA |
| In vivo Model | None |
| Lethal Dose | NA |
| Immune Response | NA |
| Mechanism of Action | Membrane depolarization and permeabilization |
| Target | Cell envelope |
| Combination Therapy | None |
| Other Activities | Antibacterial and Antiparasitic |
| Pubmed ID | 23716047 |
| Year of Publication | 2013 |
| 3-D Structure | NA |