| Primary information |
|---|
| ID | antitb_1370 |
| Peptide Name | Human neutrophil peptides-1 |
| Sequence | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
| Linear/ Cyclic | cyclic |
| Length | 30 |
| Chirality | L |
| Nature | Cationic |
| Source | Synthetic |
| Origin | Human neutrophils |
| Species | Mycobacterium tuberculosis |
| Strain | Mycobacterium tuberculosis H37 Ra |
| Inhibition Concentartion | NA |
| In vitro/In vivo | in vitro |
| Cell Line | None |
| Inhibition Concentartion | NA |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Response | NA |
| Mechanism of Action | NA |
| Target | Mycobacterial genomic DNA |
| Combination Therapy | NA |
| Other Activities | antibacterial against candida albicans |
| Pubmed ID | 11375668 |
| Year of Publication | 2000 |
| 3-D Structure | NA |