Browse result page of AntiTbPdb
The total number entries retrieved from this search are 87
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1590 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.991± 0.23 at peptide concentration 32 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1591 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.90± 0.20 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1592 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.80 ± 0.15 at peptide concentration 128 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1593 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.91 ± 0.19 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1594 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.89 ± 0.19 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1595 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.70 ± 0.15 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1596 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.90 ± 0.09 at peptide concentration 4 μg/ml + INH 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1597 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.91 ± 0.19 at peptide concentration 64 μg/ml + INH 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1598 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.93 ± 0.07 at peptide concentration 8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | INH+peptide | NA | 2004 | 15245864 |
| antitb_1599 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.78 ± 0.15 at peptide concentration 16 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | INH+peptide | NA | 2004 | 15245864 |
| antitb_1600 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.80 ± 0.14 at peptide concentration 32 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1601 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.66 ± 0.15 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1602 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.60 ± 0.17 at peptide concentration 128 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1603 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 0.68 ± 0.30 at peptide 64ul + 4 ul of INH | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide(64 ul) + INH(4 ul) | NA | 2004 | 15245864 |
| antitb_1604 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-14 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 1.99 ± 0.44 at peptide 64ul + 4 ul of INH | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide(64 ul) + INH(4 ul) | NA | 2004 | 15245864 |
| antitb_1605 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide(64 ul) + INH(4 ul) | NA | 2004 | 15245864 |
| antitb_1606 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 0.90 ± 0.75 at peptide 64ul + 4 ul of INH | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide(64 ul) + INH(4 ul) | NA | 2004 | 15245864 |
| antitb_1651 | Human neutrohil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Synthetic | Human neutrophil | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | IC50 = 0.8μg/ml | in vitro | murine macrophage-like cell line J744A.1 | NA | cytotoxic at above concentration 5 ug/ml | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2016 | 10933095 |
| antitb_1652 | Human neutrohil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Synthetic | Human neutrophil | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | IC90 = 2.5 μg/ml | in vitro | murine macrophage-like cell line J744A.1 | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2016 | 10933095 |
| antitb_1702 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 7632G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1703 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys30 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 9034G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1704 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys31 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 11170G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1708 | Porcine leucocyte peptide (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | porcine neutrophil leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 7632G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1709 | Porcine leucocyte peptide (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-14 | Cyclic | 18 | L | Cationic | Natural | porcine neutrophil leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 9034G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1710 | Porcine leucocyte peptide (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-15 | Cyclic | 18 | L | Cationic | Natural | porcine neutrophil leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 11170G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1711 | Porcine leucocyte peptide (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-16 | Cyclic | 18 | L | Cationic | Natural | porcine neutrophil leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37 Ra | IC50= 5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1712 | Porcine leucocyte peptide (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-17 | Cyclic | 18 | L | Cationic | Natural | porcine neutrophil leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37 Ra | MIC = 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1716 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 25291 | Reduction in CFU at 5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1717 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 25291 | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1718 | Human neutrophil peptide (HNP-2) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys1-cys29, cys3-cys18,cys8-cys28 | 29 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 25291 | Reduction in bacterial load to 64 % at 5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 | |
| antitb_1719 | Human neutrophil peptide (HNP-3) | DCYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 25291 | Reduction in bacterial load to 61 % 5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 | |
| antitb_1720 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain SJB | Reduction in CFU/well 91.8 ± 1.1 at peptide concentration 50μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1721 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 292524 | Reduction in CFU/well70.6 ± 0.6 at peptide concentration 50μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1722 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 475049 | Reduction in CFU/well 32.5 ± 10.7 at peptide concentration 50μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1777 | Mitogenic defensin | MEKKSFAGLCFLFLVLFVAQECVLQTEAKTCENLADTFRGPCFATGNCDDHCKNKEHLLRGRCRDDFRCWCTRNC | Free | Free | Disulfide linkage | Cyclic | 75 | L | Cationic | Natural | From the seeds of white cloud beans (Phaseolus vulgaris cv. ‘white cloud bean’) | Mycobacterium phlei | Mycobacterium phlei | IC50 = 86 ± 6 µM | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial, Antifungal | 2006 | 16687191 |
| antitb_1810 | Mcdef | GFGCPNDYSCSNHCRDSIGCRGGYCKYQLICTCYGCKKRRSIQE | Free | Free | 4 disulfide linkages between 4-25, 10-31, 14-33, 20-36 | Cyclic | 44 | L | Cationic | Protein Derived | detected in hemocytes of Manila clams (Ruditapes philippinarum). | Mycobacterium fortuitum | Mycobacterium fortuitum | MIC >20 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial (Staphylococcus aureus KCTC 1916, Streptococcus iniae KCTC 3651, orynebacterium diphtheriae, Bacillus subtilis, ibrio logei KCCM 12281, Vibrio salmonicida KCCM 41663) | 2011 | 21945146 |
| antitb_1915 | Laterosporulin 10 | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEWGGPCQL | Free | Free | Disulphide bond between residues 2-43, 6-35 and 20-51 | Cyclic | 53 | D | Cationic | Natural | Derived from Brevibacillus species SKDU10 | Mycobacterium smegmatis | Mycobacterium smegmatis MC2 155 | MIC = 45 μM | In vitro and ex vivo | RAW 264.7 murine macrophage | NA | No cytotoxicity upto 40 μM/ml concentration | NA | NA | NA | NA | Cell wall pore formation | 0.00625 μM of rifampicin with 0.25 μM of peptide, a fourfold reduction in MIC of rifampicin against H37 RV | Antibacterial against Staphylococcus aureus MTCC 1430, Bacillus subtilis MTCC 121, Pseudomonas aeruginosa MTCC 1934, Vibrio cholerae MTCC 3904, Escherichia coli MTCC 1610 | 2016 | 27267959 |