Primary information |
---|
ID | antitb_1591 |
Peptide Name | β-Defensin-1(HBD-1) |
Sequence | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Linear/ Cyclic | Cyclic |
Length | 36 |
Chirality | L |
Nature | Cationic |
Source | Natural |
Origin | Derived from beta defensin 1 OF HUMAN |
Species | Mycobacterium tuberculosis |
Strain | Mycobacterium tuberculosis H37Rv |
Inhibition Concentartion | CFU/well 2.90± 0.20 at peptide concentration 64 μg/ml |
In vitro/In vivo | in vitro |
Cell Line | NA |
Inhibition Concentartion | NA |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Response | NA |
Mechanism of Action | Bacterial membrane pore formation |
Target | NA |
Combination Therapy | NA |
Other Activities | NA |
Pubmed ID | 15245864 |
Year of Publication | 2004 |
3-D Structure | NA |