Welcome to Peptide Card of AntiTbPdb
| This page displays user query in tabular form. |
DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK details |
| Primary information | |
|---|---|
| ID | antitb_1583, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | CFU/well 3.11 ± 0.10 at peptide concentration 4 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1584, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | CFU/well 3.15 ± 0.0.16 at peptide concentration 64 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1585, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | CFU/well 1.31 ± 0.10 at peptide concentration 4 μg/ml + INH 0.06 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | peptide +INH |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1586, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | peptide +INH |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1587, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | CFU/well 3.15 ± 0.20 at peptide concentration 4 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1588, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | CFU/well 3.21 ± 0.42 at peptide concentration 8 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1589, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | CFU/well 3.02 ± 0.30 at peptide concentration 16 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1590, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | CFU/well 2.991± 0.23 at peptide concentration 32 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1591, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | CFU/well 2.90± 0.20 at peptide concentration 64 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1592, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | CFU/well 2.80 ± 0.15 at peptide concentration 128 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1593, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
| Cell Line | CFU/well 2.91 ± 0.19 at peptide concentration 4 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1594, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
| Cell Line | CFU/well 2.89 ± 0.19 at peptide concentration 4 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1595, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
| Cell Line | CFU/well 2.70 ± 0.15 at peptide concentration 64 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1596, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
| Cell Line | CFU/well 2.90 ± 0.09 at peptide concentration 4 μg/ml + INH 4 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1597, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
| Cell Line | CFU/well 2.91 ± 0.19 at peptide concentration 64 μg/ml + INH 4 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1598, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
| Cell Line | CFU/well 2.93 ± 0.07 at peptide concentration 8 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | INH+peptide |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1599, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
| Cell Line | CFU/well 2.78 ± 0.15 at peptide concentration 16 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | INH+peptide |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1600, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
| Cell Line | CFU/well 2.80 ± 0.14 at peptide concentration 32 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1601, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
| Cell Line | CFU/well 2.66 ± 0.15 at peptide concentration 64 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1602, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
| Cell Line | CFU/well 2.60 ± 0.17 at peptide concentration 128 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1605, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | Peptide(64 ul) + INH(4 ul) |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1606, |
| Name | 15245864 |
| N-Terminal modification | β-Defensin-1(HBD-1) |
| C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
| Chirality | Cyclic |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from beta defensin 1 OF HUMAN |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
| Cell Line | CFU/well 0.90 ± 0.75 at peptide 64ul + 4 ul of INH |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Bacterial membrane pore formation |
| Other activities | NA |
| PMID | Peptide(64 ul) + INH(4 ul) |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |