| Primary information |
|---|
| ID | antitb_1535, |
| Name | 25613372 |
| N-Terminal modification | Human neutrohil peptide (HNP-1) |
| C-Terminal Modification | DCYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
| Chirality | Cyclic |
| Nature | 30 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Human neutrophil |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | 2.5 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2015 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | No cytotoxicity |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | Mediate macrophage to induce TNF-α expression |
| Combination Therapy | Inhibit lipid biosynthesi |
| Other activities | NA |
| PMID | NA |
| Year of Publication | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas |
Tertiary Structure
(Technique) | Not Predicted), |
| Primary information |
|---|
| ID | antitb_1536, |
| Name | 25613372 |
| N-Terminal modification | Human neutrohil peptide (HNP-1) |
| C-Terminal Modification | DCYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
| Chirality | Cyclic |
| Nature | 30 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Human neutrophil |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | IC50=0.0375 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2015 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | Mediate macrophage to induce TNF-α expression |
| Combination Therapy | Inhibit lipid biosynthesi |
| Other activities | NA |
| PMID | HNP-1 + Rifampicin |
| Year of Publication | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas |
Tertiary Structure
(Technique) | Not Predicted), |
| Primary information |
|---|
| ID | antitb_1537, |
| Name | 25613372 |
| N-Terminal modification | Human neutrohil peptide (HNP-1) |
| C-Terminal Modification | DCYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
| Chirality | Cyclic |
| Nature | 30 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Human neutrophil |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | IC50= 0.0255 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2015 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | Mediate macrophage to induce TNF-α expression |
| Combination Therapy | Inhibit lipid biosynthesi |
| Other activities | NA |
| PMID | HNP-1 + Isoniazid |
| Year of Publication | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas |
Tertiary Structure
(Technique) | Not Predicted), |
| Primary information |
|---|
| ID | antitb_1719, |
| Name | 1398982 |
| N-Terminal modification | Human neutrophil peptide (HNP-3) |
| C-Terminal Modification | DCYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
| Chirality | |
| Nature | 30 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Human neutrophil |
| Inhibition Concentration | Mycobacterium avium- mycobacterium intracellularae |
| In Vitro/ In vivo | Mycobacterium avium- mycobacterium intracellularae strain 25291 |
| Cell Line | Reduction in bacterial load to 61 % 5 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 1992 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
Tertiary Structure
(Technique) | Not Predicted), |