A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11282 |
| Swiss-prot Accession number | P01193 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | Met-enkephalin is an endogenous opiate |
| Protein Length | 235 Amino acids |
| Molecular weight | 26707 |
| References | 1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Met-enkephalin |
| Mature Hormone Sequence | YGGFM |
| Position of mature hormone in Pre-Hormone protein | 5 Residues from position (205-209) |
| Receptor | Q64326 Detail in HMRbase Q01727 Detail in HMRbase |
| Gene ID | 18976 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |
| HMRbase accession number | 11283 |
| Swiss-prot Accession number | P01193 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes |
| Protein Length | 235 Amino acids |
| Molecular weight | 26707 |
| References | 1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Melanotropin gamma (Gamma-MSH) |
| Mature Hormone Sequence | YVMGHFRWDRF |
| Position of mature hormone in Pre-Hormone protein | 11 Residues from position (77-87) |
| Receptor | Q64326 Detail in HMRbase Q01727 Detail in HMRbase |
| Gene ID | 18976 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |
| HMRbase accession number | 11284 |
| Swiss-prot Accession number | P01193 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | ACTH stimulates the adrenal glands to release cortisol |
| Protein Length | 235 Amino acids |
| Molecular weight | 26707 |
| References | 1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Corticotropin |
| Mature Hormone Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF |
| Position of mature hormone in Pre-Hormone protein | 39 Residues from position (124-162) |
| Receptor | Q64326 Detail in HMRbase Q01727 Detail in HMRbase |
| Gene ID | 18976 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |
| HMRbase accession number | 11285 |
| Swiss-prot Accession number | P01193 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes |
| Protein Length | 235 Amino acids |
| Molecular weight | 26707 |
| References | 1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Melanotropin alpha (Alpha-MSH) |
| Mature Hormone Sequence | SYSMEHFRWGKPV |
| Position of mature hormone in Pre-Hormone protein | 13 Residues from position (124-136) |
| Receptor | Q64326 Detail in HMRbase Q01727 Detail in HMRbase |
| Gene ID | 18976 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |
| HMRbase accession number | 11286 |
| Swiss-prot Accession number | P01193 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis. |
| Protein Length | 235 Amino acids |
| Molecular weight | 26707 |
| References | 1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Lipotropin beta (Beta-LPH) |
| Mature Hormone Sequence | ELEGERPLGLEQVLESDAEKDDGPYRVEHFRWSNPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ |
| Position of mature hormone in Pre-Hormone protein | 71 Residues from position (165-235) |
| Receptor | Q64326 Detail in HMRbase Q01727 Detail in HMRbase |
| Gene ID | 18976 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |
| HMRbase accession number | 11287 |
| Swiss-prot Accession number | P01193 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis. |
| Protein Length | 235 Amino acids |
| Molecular weight | 26707 |
| References | 1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Lipotropin gamma (Gamma-LPH) |
| Mature Hormone Sequence | ELEGERPLGLEQVLESDAEKDDGPYRVEHFRWSNPPKD |
| Position of mature hormone in Pre-Hormone protein | 38 Residues from position (165-202) |
| Receptor | Q64326 Detail in HMRbase Q01727 Detail in HMRbase |
| Gene ID | 18976 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |
| HMRbase accession number | 11288 |
| Swiss-prot Accession number | P01193 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes |
| Protein Length | 235 Amino acids |
| Molecular weight | 26707 |
| References | 1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Melanotropin beta (Beta-MSH) |
| Mature Hormone Sequence | DDGPYRVEHFRWSNPPKD |
| Position of mature hormone in Pre-Hormone protein | 18 Residues from position (185-202) |
| Receptor | Q64326 Detail in HMRbase Q01727 Detail in HMRbase |
| Gene ID | 18976 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |
| HMRbase accession number | 11289 |
| Swiss-prot Accession number | P01193 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | Beta-endorphin is an endogenous opiate |
| Protein Length | 235 Amino acids |
| Molecular weight | 26707 |
| References | 1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Beta-endorphin |
| Mature Hormone Sequence | YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ |
| Position of mature hormone in Pre-Hormone protein | 31 Residues from position (205-235) |
| Receptor | Q64326 Detail in HMRbase Q01727 Detail in HMRbase |
| Gene ID | 18976 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |