A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11286 |
Swiss-prot Accession number | P01193 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Mus musculus (Mouse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis. |
Protein Length | 235 Amino acids |
Molecular weight | 26707 |
References | 1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Lipotropin beta (Beta-LPH) |
Mature Hormone Sequence | ELEGERPLGLEQVLESDAEKDDGPYRVEHFRWSNPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ |
Position of mature hormone in Pre-Hormone protein | 71 Residues from position (165-235) |
Receptor | Q64326 Detail in HMRbase Q01727 Detail in HMRbase |
Gene ID | 18976 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |