![]() |
|
|
|
|
|
|
HMRbase accession number | 10334 |
Swiss-prot Accession number | Q8CIT0 (Sequence in FASTA format) |
Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
Source organism | Mus musculus (Mouse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
Protein Length | 187 Amino acids |
Molecular weight | 20778 |
References | 1 Seasholtz A.F., Bourbonais F.J., Harnden C.E., Camper S.A.; "Nucleotide sequence and expression of the mouse corticotropin-releasing hormone gene."; Mol. Cell. Neurosci. 2:266-273(1991).
|
Domain Name | CRF |
Hormone Name | Corticoliberin |
Mature Hormone Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (145-185) |
Receptor | P35347 Detail in HMRbase Q60748 Detail in HMRbase |
Gene ID | 12918 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10344 |
Swiss-prot Accession number | Q95MI6 (Sequence in FASTA format) |
Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
Source organism | Bos taurus (Bovine) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
Protein Length | 190 Amino acids |
Molecular weight | 20739 |
References | 1 Buchanan F.C., Thue T.D., Schmutz S.M.; "Sequence analysis of bovine corticotrophin-releasing hormone - acandidate gene for post-natal growth."; Submitted (JAN-2001) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | CRF |
Hormone Name | Corticoliberin |
Mature Hormone Sequence | SQEPPISLDLTFHLLREVLEMTKADQLAQQAHXNRKLLDIA |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (148-188) |
Receptor | Q9BGU4
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10359 |
Swiss-prot Accession number | Q9PTS1 (Sequence in FASTA format) |
Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
Source organism | Carassius auratus (Goldfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
Protein Length | 162 Amino acids |
Molecular weight | 18418 |
References | 1 PubMed abstract 10603283 |
Domain Name | CRF |
Hormone Name | Corticoliberin |
Mature Hormone Sequence | SEEPPISLDLTFHLLREVLEMARAEQMAQQAHSNRKMMEIF |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (120-160) |
Receptor | Q49MT7 Detail in HMRbase Q49MT8 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10590 |
Swiss-prot Accession number | P49926 (Sequence in FASTA format) |
Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
Source organism | Canis familiaris (Dog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
Protein Length | 196 Amino acids |
Molecular weight | 21547 |
References | 1 Kansaku N., Yamagishi K., Mizushima S.; "PCR cloning of dog corticotropin releasing hormone gene."; Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 7969821 |
Domain Name | CRF |
Hormone Name | Corticoliberin |
Mature Hormone Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (154-194) |
Receptor | N/A |
Gene ID | 486977 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10591 |
Swiss-prot Accession number | P06296 (Sequence in FASTA format) |
Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
Protein Length | 191 Amino acids |
Molecular weight | 21042 |
References | 1 PubMed abstract 9734873 2 PubMed abstract 12030933 3 PubMed abstract 3878520 |
Domain Name | CRF |
Hormone Name | Corticoliberin |
Mature Hormone Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (149-189) |
Receptor | N/A |
Gene ID | 100127468 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11241 |
Swiss-prot Accession number | P01142 (Sequence in FASTA format) |
Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone) (Endorpholiberin). |
Source organism | Ovis aries (Sheep) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
Protein Length | 190 Amino acids |
Molecular weight | 20672 |
References | 1 PubMed abstract 6600512 2 PubMed abstract 3265687 3 PubMed abstract 6273874 4 PubMed abstract 6267699 5 PubMed abstract 2647152 |
Domain Name | CRF |
Hormone Name | Corticoliberin |
Mature Hormone Sequence | SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (148-188) |
Receptor | O62772
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11242 |
Swiss-prot Accession number | P01143 (Sequence in FASTA format) |
Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
Source organism | Rattus norvegicus (Rat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
Protein Length | 187 Amino acids |
Molecular weight | 20680 |
References | 1 PubMed abstract 3876950 2 PubMed abstract 3274895 3 PubMed abstract 6603620 |
Domain Name | CRF |
Hormone Name | Corticoliberin |
Mature Hormone Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (145-185) |
Receptor | P35353 Detail in HMRbase P47866 Detail in HMRbase |
Gene ID | 81648 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11377 |
Swiss-prot Accession number | P06850 (Sequence in FASTA format) |
Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
Protein Length | 196 Amino acids |
Molecular weight | 21422 |
References | 1 PubMed abstract 6605851 2 PubMed abstract 2783917 3 Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,Phelan M., Farmer A.; "Cloning of human full-length CDSs in BD Creator(TM) system donorvector."; Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases. 4 PubMed abstract 15489334 5 PubMed abstract 3262120 6 PubMed abstract 8386360 |
Domain Name | CRF |
Hormone Name | Corticoliberin |
Mature Hormone Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (154-194) |
Receptor | P34998 Detail in HMRbase Q13324 Detail in HMRbase |
Gene ID | 1392 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11467 |
Swiss-prot Accession number | P49188 (Sequence in FASTA format) |
Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
Source organism | Xenopus laevis (African clawed frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
Protein Length | 162 Amino acids |
Molecular weight | 17880 |
References | 1 PubMed abstract 1448118 2 Yao M., Stenzel-Poore M.P., Denver R.J.; "Structural and functional analysis of corticotropin-releasing factorgenes of the South African clawed frog, Xenopus laevis."; Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases. |
Domain Name | CRF |
Hormone Name | Corticoliberin |
Mature Hormone Sequence | AEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (120-160) |
Receptor | O42602 Detail in HMRbase O42603 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |