![]() |
|
|
|
|
|
|
HMRbase accession number | 10192 |
Swiss-prot Accession number | P87352 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Gamma-melanotropin-like segment; Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Melanotropin beta(Beta-MSH); Beta-endorphin; Met-enkephalin]. |
Source organism | Acipenser transmontanus (White sturgeon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Chondrostei; Acipenseriformes; Acipenseridae;Acipenser. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Precursor protein for pituitary hormones that regulate stress and environmental adaptation |
Protein Length | 263 Amino acids |
Molecular weight | 30163 |
References | 1 PubMed abstract 9016801 2 PubMed abstract 9016801 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMKSWDERSQKPLLTLFKNVMIKDGHEKKGQ |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (230-263) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10197 |
Swiss-prot Accession number | Q91082 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Gamma-melanotropin-like segment; Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Melanotropin beta(Beta-MSH); Beta-endorphin; Met-enkephalin]. |
Source organism | Lepisosteus osseus (Long-nosed gar) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Semionotiformes; Lepisosteidae;Lepisosteus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Precursor protein for pituitary hormones that regulate stress and environmental adaptation |
Protein Length | 259 Amino acids |
Molecular weight | 29675 |
References | 1 PubMed abstract 9268621 2 PubMed abstract 9268621 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMKSWDERSQKPLLTLFKNVIIKDGHQKKGQ |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (226-259) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10377 |
Swiss-prot Accession number | Q9YGK4 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin 1 precursor (Corticotropin-lipotropin I)(Pro-opiomelanocortin I) (POMC I) [Contains: Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 25417 |
References | 1 PubMed abstract 9806347 2 PubMed abstract 9806347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMKSWDERSQKPLLTLFKNVINKEHQKKDQ |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (190-222) |
Receptor | Q683Z6 Detail in HMRbase Q683Z7 Detail in HMRbase Q6EWJ2 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10384 |
Swiss-prot Accession number | Q9YGK5 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin 2 precursor (Corticotropin-lipotropin II)(Pro-opiomelanocortin II) (POMC II) [Contains: Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 25385 |
References | 1 PubMed abstract 9806347 2 PubMed abstract 9806347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMKSWDERSQKPLLTLFKNVINKEHQKKDQ |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (190-222) |
Receptor | Q683Z6 Detail in HMRbase Q683Z7 Detail in HMRbase Q6EWJ2 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10921 |
Swiss-prot Accession number | P06298 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC-A)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Xenopus laevis (African clawed frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 259 Amino acids |
Molecular weight | 29879 |
References | 1 PubMed abstract 3754961 2 PubMed abstract 1584015 3 Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 4 PubMed abstract 3840481 5 PubMed abstract 2564347 6 PubMed abstract 3754961 7 PubMed abstract 1584015 8 Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 9 PubMed abstract 3840481 10 PubMed abstract 2564347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMTPERSQTPLMTLFKNAIIKNSHKKGQ |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (229-259) |
Receptor | N/A |
Gene ID | 380532 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10933 |
Swiss-prot Accession number | P21252 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment). |
Source organism | Loxodonta africana (African elephant) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Beta-endorphin is an endogenous opiate |
Protein Length | 134 Amino acids |
Molecular weight | 14935 |
References | 1 PubMed abstract 2854538 2 PubMed abstract 2854538 |
Domain Name | ACTH_domain Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGH |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (104-134) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10940 |
Swiss-prot Accession number | P11280 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment). |
Source organism | Mustela vison (American mink) (Neovison vison) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Beta-endorphin is an endogenous peptide |
Protein Length | 142 Amino acids |
Molecular weight | 15822 |
References | 1 PubMed abstract 3397057 2 PubMed abstract 3382437 3 PubMed abstract 3397057 4 PubMed abstract 3382437 |
Domain Name | ACTH_domain Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (112-142) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10947 |
Swiss-prot Accession number | P10000 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin]. |
Source organism | Oncorhynchus keta (Chum salmon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 226 Amino acids |
Molecular weight | 24982 |
References | 1 PubMed abstract 3197404 2 PubMed abstract 6095185 3 PubMed abstract 6087806 4 PubMed abstract 7447938 5 PubMed abstract 475783 6 PubMed abstract 3197404 7 PubMed abstract 6095185 8 PubMed abstract 6087806 9 PubMed abstract 7447938 10 PubMed abstract 475783 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMKPYTKQSHKPLITLLKHITLKNEQ |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (198-226) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10957 |
Swiss-prot Accession number | P11885 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Rana catesbeiana (Bull frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 263 Amino acids |
Molecular weight | 30389 |
References | 1 PubMed abstract 2788269 2 PubMed abstract 1331997 3 PubMed abstract 2788269 4 PubMed abstract 1331997 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMTPERSQTPLMTLFKNAIIKNAHKKGQ |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (233-263) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10965 |
Swiss-prot Accession number | P22923 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Rana ridibunda (Laughing frog) (Marsh frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Pelophylax. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 260 Amino acids |
Molecular weight | 30068 |
References | 1 PubMed abstract 2260977 2 PubMed abstract 2260977 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMTPERSQTPLMTLFKNAIIKNAHKKGQ |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (230-260) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10973 |
Swiss-prot Accession number | P01194 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Rattus norvegicus (Rat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Beta-endorphin is an endogenous opiate |
Protein Length | 235 Amino acids |
Molecular weight | 26540 |
References | 1 PubMed abstract 2998878 2 PubMed abstract 6547437 3 PubMed abstract 6255341 4 PubMed abstract 7259753 5 PubMed abstract 2998878 6 PubMed abstract 6547437 7 PubMed abstract 6255341 8 PubMed abstract 7259753 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (205-235) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10981 |
Swiss-prot Accession number | Q9YGK2 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin]. |
Source organism | Thunnus obesus (Bigeye tuna) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Thunnus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 222 Amino acids |
Molecular weight | 24970 |
References | 1 Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases.
2 Amemiya Y., Takahashi A., Kawauchi H.; "Tuna proopiomelanocortin cDNA."; Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases. |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMKSWDERSQRPLLTLFKNVINKDGQQQK |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (191-222) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11256 |
Swiss-prot Accession number | P01189 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin]. |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. O-glycosylated; reducing sugar is probably N- acetylgalactosamine. |
Function | Beta-endorphin is an endogenous opiate |
Protein Length | 267 Amino acids |
Molecular weight | 29424 |
References | 1 PubMed abstract 6274691 2 PubMed abstract 6299668 3 PubMed abstract 6314261 4 PubMed abstract 15489334 5 PubMed abstract 3606677 6 PubMed abstract 6254047 7 PubMed abstract 6945581 8 PubMed abstract 6267033 9 PubMed abstract 6272808 10 PubMed abstract 4352834 11 PubMed abstract 14463577 12 PubMed abstract 15340161 13 PubMed abstract 4334191 14 PubMed abstract 4338630 15 PubMed abstract 4347148 16 PubMed abstract 1264228 17 Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 18 PubMed abstract 195688 19 PubMed abstract 2424570 20 PubMed abstract 2839146 21 PubMed abstract 7828531 22 PubMed abstract 9620771 23 PubMed abstract 16046320 24 PubMed abstract 16807684 25 PubMed abstract 9768693 26 PubMed abstract 10193875 27 PubMed abstract 11244459 28 PubMed abstract 12165561 29 PubMed abstract 6274691 30 PubMed abstract 6299668 31 PubMed abstract 6314261 32 PubMed abstract 15489334 33 PubMed abstract 3606677 34 PubMed abstract 6254047 35 PubMed abstract 6945581 36 PubMed abstract 6267033 37 PubMed abstract 6272808 38 PubMed abstract 4352834 39 PubMed abstract 14463577 40 PubMed abstract 15340161 41 PubMed abstract 4334191 42 PubMed abstract 4338630 43 PubMed abstract 4347148 44 PubMed abstract 1264228 45 Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 46 PubMed abstract 195688 47 PubMed abstract 2424570 48 PubMed abstract 2839146 49 PubMed abstract 7828531 50 PubMed abstract 9620771 51 PubMed abstract 16046320 52 PubMed abstract 16807684 53 PubMed abstract 9768693 54 PubMed abstract 10193875 55 PubMed abstract 11244459 56 PubMed abstract 12165561 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (237-267) |
Receptor | Q01726
Detail in HMRbase |
Gene ID | 5443 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11258 |
Swiss-prot Accession number | P01190 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Bos taurus (Bovine) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Beta-endorphin is an endogenous opiate |
Protein Length | 265 Amino acids |
Molecular weight | 29260 |
References | 1 PubMed abstract 221818 2 PubMed abstract 6249166 3 PubMed abstract 6263630 4 Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5 Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6 PubMed abstract 216007 7 PubMed abstract 7274457 8 PubMed abstract 13642798 9 Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10 PubMed abstract 4344689 11 Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12 Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13 PubMed abstract 13348631 14 PubMed abstract 1065904 15 PubMed abstract 4030947 16 PubMed abstract 2266117 17 PubMed abstract 221818 18 PubMed abstract 6249166 19 PubMed abstract 6263630 20 Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21 Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22 PubMed abstract 216007 23 PubMed abstract 7274457 24 PubMed abstract 13642798 25 Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26 PubMed abstract 4344689 27 Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28 Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29 PubMed abstract 13348631 30 PubMed abstract 1065904 31 PubMed abstract 4030947 32 PubMed abstract 2266117 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (235-265) |
Receptor | P47798
Detail in HMRbase |
Gene ID | 281416 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11272 |
Swiss-prot Accession number | P01191 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment). |
Source organism | Ovis aries (Sheep) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Beta-endorphin is an endogenous opiate |
Protein Length | 212 Amino acids |
Molecular weight | 23464 |
References | 1 PubMed abstract 8384993 2 Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3 PubMed abstract 4344689 4 PubMed abstract 4370084 5 PubMed abstract 13929167 6 PubMed abstract 4162144 7 PubMed abstract 4675453 8 PubMed abstract 4270658 9 PubMed abstract 843377 10 PubMed abstract 8384993 11 Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12 PubMed abstract 4344689 13 PubMed abstract 4370084 14 PubMed abstract 13929167 15 PubMed abstract 4162144 16 PubMed abstract 4675453 17 PubMed abstract 4270658 18 PubMed abstract 843377 |
Domain Name | ACTH_domain Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (182-212) |
Receptor | Q9TU77 Detail in HMRbase O19037 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11280 |
Swiss-prot Accession number | P01192 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Beta-endorphin is an endogenous opiate |
Protein Length | 267 Amino acids |
Molecular weight | 28895 |
References | 1 PubMed abstract 3753882 2 PubMed abstract 6196724 3 PubMed abstract 7958386 4 PubMed abstract 6547437 5 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6 PubMed abstract 4334191 7 PubMed abstract 4369114 8 PubMed abstract 2174774 9 PubMed abstract 13451616 10 PubMed abstract 5543613 11 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12 PubMed abstract 4673865 13 PubMed abstract 13348631 14 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15 PubMed abstract 1207728 16 PubMed abstract 1007884 17 PubMed abstract 3753882 18 PubMed abstract 6196724 19 PubMed abstract 7958386 20 PubMed abstract 6547437 21 Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22 PubMed abstract 4334191 23 PubMed abstract 4369114 24 PubMed abstract 2174774 25 PubMed abstract 13451616 26 PubMed abstract 5543613 27 Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28 PubMed abstract 4673865 29 PubMed abstract 13348631 30 Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31 PubMed abstract 1207728 32 PubMed abstract 1007884 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (237-267) |
Receptor | Q9TU05
Detail in HMRbase |
Gene ID | 396863 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11289 |
Swiss-prot Accession number | P01193 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Mus musculus (Mouse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Beta-endorphin is an endogenous opiate |
Protein Length | 235 Amino acids |
Molecular weight | 26707 |
References | 1 PubMed abstract 6303853 2 PubMed abstract 6308009 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 2536749 6 PubMed abstract 1689057 7 PubMed abstract 221916 8 PubMed abstract 6303853 9 PubMed abstract 6308009 10 PubMed abstract 16141072 11 PubMed abstract 15489334 12 PubMed abstract 2536749 13 PubMed abstract 1689057 14 PubMed abstract 221916 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (205-235) |
Receptor | Q64326 Detail in HMRbase Q01727 Detail in HMRbase |
Gene ID | 18976 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11297 |
Swiss-prot Accession number | P01201 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin]. |
Source organism | Macaca nemestrina (Pig-tailed macaque) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Beta-endorphin is an endogenous opiate |
Protein Length | 264 Amino acids |
Molecular weight | 29172 |
References | 1 PubMed abstract 3229286 2 PubMed abstract 13760276 3 PubMed abstract 3229286 4 PubMed abstract 13760276 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGQ |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (234-264) |
Receptor | Q864J8
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11421 |
Swiss-prot Accession number | P19402 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Cavia porcellus (Guinea pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Beta-endorphin is an endogenous opiate |
Protein Length | 256 Amino acids |
Molecular weight | 28264 |
References | 1 PubMed abstract 1662166 2 PubMed abstract 2830360 3 PubMed abstract 1662166 4 PubMed abstract 2830360 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Beta-endorphin |
Mature Hormone Sequence | YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (226-256) |
Receptor | Q9Z1S9
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |