Fermented Food Database
This is the result page of browse. This page gives the information about peptides returned against the selected category. Further details of the peptide can be seen by clicking on the FMDB_ID. Further the user can sort the peptides on the basis of various fields by clicking on the respective headers.
The total number entries retrieved from this search are 161| FMDB_ID | PubMed ID | Reference | Title | Peptide_Sequence | Sequence | Length of peptide | Food_Matrix | Protein | pH | Temperature | Incubation Time | Activity | Experiment | Model | Assay for Activity Measurement | Culture | Hydrolysis | Method of analysis | M_Z ratio | Mass | IC50 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| FMDB4 | 8201050 | NA | NA | AYFYPE | AYFYPE | 6 | Milk | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790 | proteinase | NA | NA | NA | 106uM |
| FMDB5 | 8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | proteases | NA | NA | NA | 4uM |
| FMDB6 | 8201050 | NA | NA | GPFPIIV | GPFPIIV | 7 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | proteases | NA | NA | NA | 4uM |
| FMDB7 | 8201050 | NA | NA | GTQYTDAPSFSDIPNPIGSENSEKTTMPLW | GTQYTDAPSFSDIPNPIGSENSEKTTMPLW | 30 | Milk | αS1-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 346uM |
| FMDB8 | 8201050 | NA | NA | KYPVQPFTESQSLTL | KYPVQPFTESQSLTL | 15 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 93uM |
| FMDB9 | 8201050 | NA | NA | SVLSLSESKVLPVPE | SVLSLSESKVLPVPE | 15 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 39uM |
| FMDB10 | 8201050 | NA | NA | PPQSVLSLSESKVLPVPE | PPQSVLSLSESKVLPVPE | 18 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 25uM |
| FMDB11 | 8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 209uM |
| FMDB12 | 8201050 | NA | NA | YQQPVLGPVRGPFPIIV | YQQPVLGPVRGPFPIIV | 17 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 101uM |
| FMDB13 | 8201050 | NA | NA | LPQNIPPLTQTPVVVPPFLQPEVMGVSK | LPQNIPPLTQTPVVVPPFLQPEVMGVSK | 28 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 144uM |
| FMDB14 | 8201050 | NA | NA | LLYQQPVLGPVRGPFPIIV | LLYQQPVLGPVRGPFPIIV | 19 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 21uM |
| FMDB15 | 8201050 | NA | NA | DELQDKIHPFATQSLVYPFPGPIHNS | DELQDKIHPFATQSLVYPFPGPIHNS | 26 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 4uM |
| FMDB16 | 8201050 | NA | NA | AVPYPQR | AVPYPQR | 7 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 15uM |
| FMDB17 | 12369200 | NA | NA | IPP | IPP | 3 | calpis sour Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus and Saccharomyces cerevisiae | Proteinase | NA | NA | NA | 5 micro mol /l |
| FMDB18 | 12369200 | NA | NA | IPP | IPP | 3 | calpis sour Milk | k-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus and Saccharomyces cerevisiae | Proteinase | NA | NA | NA | 5 micro mol /l |
| FMDB19 | 12369200 | NA | NA | VPP | VPP | 3 | calpis sour Milk | bovine β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus and Saccharomyces cerevisiae | Proteinase | NA | NA | NA | 9micromol/l |
| FMDB20 | 7673515 | NA | NA | VPP | VPP | 3 | Skim Milk | β-Casein | 4.2 | 37C | 8-10h | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus LBK16H and Saccharomyces cerevisae | proteinase | NA | NA | NA | NA |
| FMDB21 | 7673515 | NA | NA | IPP | IPP | 3 | Skim Milk | β-Casein | 4.2 | 37C | 8-10h | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus LBK16H and Saccharomyces cerevisae | proteinase | NA | NA | NA | NA |
| FMDB22 | 7673515 | NA | NA | IPP | IPP | 3 | Skim Milk | k-Casein | 4.2 | 37C | 8-10h | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus LBK16H and Saccharomyces cerevisae | proteinase | NA | NA | NA | NA |
| FMDB23 | 10416158 | NA | NA | YP | YP | 2 | Yogurt like product | αS1-Casein | 4.3 | NA | NA | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CPN4 | proteinase | NA | NA | NA | 720uM |
| FMDB24 | 10416158 | NA | NA | YP | YP | 2 | Yogurt like product | β-Casein | 4.3 | NA | NA | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CPN4 | proteinase | NA | NA | NA | 720uM |
| FMDB25 | 10416158 | NA | NA | YP | YP | 2 | Yogurt like product | k-Casein | 4.3 | NA | NA | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CPN4 | proteinase | NA | NA | NA | 720uM |
| FMDB26 | 27435541 | NA | NA | IPP | IPP | 3 | Fermented cow Milk or dahi (2.5% skim Milk +2.5%Casein) | NA | NA | 37C | 24h | Cholestrol-lowering | In vivo | Hypercholesterolemic mice | NA | Lactobacillus helveticus strains KII13 | NA | UPLC-MS/MS. | NA | NA | NA |
| FMDB27 | 27435541 | NA | NA | VPP | VPP | 3 | Fermented cow Milk or dahi (2.5% skim Milk +2.5%Casein) | NA | NA | 37C | 24h | Cholestrol-lowering | In vivo | Hypercholesterolemic mice | NA | Lactobacillus helveticus strains KII13 | NA | UPLC-MS/MS. | NA | NA | NA |
| FMDB31 | 25222748 | NA | NA | DVWY | DVWY | 4 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 582.5 | 0.69±0.04 mM |
| FMDB32 | 25222748 | NA | NA | FDART | FDART | 5 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 609.6 | 1.9±0.1 mM |
| FMDB33 | 25222748 | NA | NA | FQ | FQ | 2 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 294.2 | 7.4±0.6 mM |
| FMDB34 | 25222748 | NA | NA | VAE | VAE | 3 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 318 | 55.9±1.9 mM |
| FMDB35 | 25222748 | NA | NA | VVG | VVG | 3 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 274.2 | 39.6±5.7 mM |
| FMDB36 | 25222748 | NA | NA | WTFR | WTFR | 4 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 609.5 | 6.7±0.5 mM |
| FMDB111 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB112 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB113 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB114 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB156 | 26996626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Milk | αS1-Casein | 3.83 ± 0.2 | 41c | 48h | Anti-microbial against S.aureus | In vivo | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2764.4 | NA | NA |
| FMDB157 | 26996626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Milk | αS1-Casein | 4.27 ± 0.15 | 41c | 48h | Anti-microbial against S.aureus | In vivo | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2764.4 | NA | NA |
| FMDB158 | 26996626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Milk | αS1-Casein | 4.32 ± 0.6 | 41c | 48h | Anti-microbial against S.aureus | In vivo | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2764.4 | NA | NA |
| FMDB159 | 26996626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Milk | αS1-Casein | 4.39± 0.22 | 41c | 48h | Anti-microbial against S.aureus | In vivo | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2764.4 | NA | NA |
| FMDB173 | 16899668 | NA | NA | LHLPLP | LHLPLP | 6 | Milk | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | Enterococcus faecalis CECT5727 | NA | NA | NA | NA | NA |
| FMDB174 | 16899668 | NA | NA | LHLPLPL | LHLPLPL | 7 | Milk | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | Enterococcus faecalis CECT5727 | NA | NA | NA | NA | NA |
| FMDB175 | 16899668 | NA | NA | LVYPFPGPIPNSLPQNIPP | LVYPFPGPIPNSLPQNIPP | 19 | Milk | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | Enterococcus faecalis CECT5727 | NA | NA | NA | NA | NA |
| FMDB176 | 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | Enterococcus faecalis CECT5727 | NA | NA | NA | NA | NA |
| FMDB177 | 16899668 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Milk | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | Enterococcus faecalis CECT5727 | NA | NA | NA | NA | NA |
| FMDB178 | NA | pan05 | Antihypertensive peptides from skimmed Milk hydrolysate digested by cell-free extract of Lactobacillus helveticus JCM1004 | VPP | VPP | 3 | Skimmed Milk | β-Casein &k Casein | 6.5-7.0 | 37c | 20h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substarte | Lactobacillus helveticus JCM1004 | proteinase and peptidase | RPHPLC and protein sequencer | NA | NA | 9.13 ± 0.21 uM |
| FMDB179 | NA | pan05 | NA | IPP | IPP | 3 | Skimmed Milk | β-Casein &k Casein | 6.5-7.0 | 37c | 20h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substarte | Lactobacillus helveticus JCM1004 | proteinase and peptidase | RPHPLC and protein sequencer | NA | NA | 5.15 ± 0.17 UM |
| FMDB775 | 11410001 | NA | NA | HHL | HHL | 3 | Korean Fermented soyabean paste | NA | NA | NA | NA | Ace-inhibitory | In vitro and In vivo | Spontaneously Hypertensive Rats | spectrophotometric assay using HHL as substrate | NA | NA | RPHPLC and Edman degradation | NA | 405 da | 2.2 ug/ml |
| FMDB776 | 11410002 | NA | NA | IPRPRPRP | IPRPRPRP | 8 | soy protein+glucose | Glycinin | NA | 30C | 48h | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | ACE In hibitory activity using FAPGG as the substrate | Bacillus sp. | proteinase | MALDI-TOF/TOF MS | NA | NA | 0.0072 +/- 0.0017mM |
| FMDB777 | 11410003 | NA | NA | PIPFP | PIPFP | 5 | soy protein+glucose | Glycinin | NA | 30C | 48h | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | ACE In hibitory activity using FAPGG as the substrate | Bacillus sp. | proteinase | MALDI-TOF/TOF MS | NA | NA | 0.0660 +/- 0.0153mM |
| FMDB778 | 11410004 | NA | NA | PVNKP | PVNKP | 5 | soy protein+glucose | Glycinin | NA | 30C | 48h | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | ACE In hibitory activity using FAPGG as the substrate | Bacillus sp. | proteinase | MALDI-TOF/TOF MS | NA | NA | 0.0461 +/- 0.0052mM |
| FMDB779 | 11410005 | NA | NA | LKPDNR | LKPDNR | 6 | soy protein+glucose | Glycinin g2 | NA | 30C | 48h | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | ACE In hibitory activity using FAPGG as the substrate | Bacillus sp. | proteinase | MALDI-TOF/TOF MS | NA | NA | 0.1208 +/- 0.0017mM |
| FMDB842 | 19994857 | NA | NA | AW | AW | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 10ug/ml |
| FMDB843 | 19994857 | NA | NA | GW | GW | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 30ug/ml |
| FMDB844 | 19994857 | NA | NA | AY | AY | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 48ug/ml |
| FMDB845 | 19994857 | NA | NA | SY | SY | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 67ug/ml |
| FMDB846 | 19994857 | NA | NA | GY | GY | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 67ug/ml |
| FMDB847 | 19994857 | NA | NA | AF | AF | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 190ug/ml |
| FMDB848 | 19994857 | NA | NA | VP | VP | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 480ug/ml |
| FMDB849 | 19994857 | NA | NA | AI | AI | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 690ug/ml |
| FMDB850 | 19994857 | NA | NA | VG | VG | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 1100ug/ml |
| FMDB853 | NA | shimakage12 | ACE inhibitory substances derived from soy foods | II | II | 2 | soy protein ( Natto) | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | B.subtilis Natto + protease (end-type neutral protease, PROTIN SD-NY10) | protease | NA | NA | NA | NA |
| FMDB854 | NA | shimakage12 | ACE inhibitory substances derived from soy foods | ID | ID | 2 | soy protein ( Natto) | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | B.subtilis Natto + protease (end-type neutral protease, PROTIN SD-NY10) | protease | NA | NA | NA | NA |
| FMDB855 | NA | shimakage12 | ACE inhibitory substances derived from soy foods | IFY | IFY | 3 | soy protein ( Natto) | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | B.subtilis Natto + protease (end-type neutral protease, PROTIN SD-NY10) | protease | NA | NA | NA | NA |
| FMDB856 | NA | shimakage12 | ACE inhibitory substances derived from soy foods | LFY | LFY | 3 | soy protein ( Natto) | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | B.subtilis Natto + protease (end-type neutral protease, PROTIN SD-NY10) | protease | NA | NA | NA | NA |
| FMDB857 | NA | shimakage12 | ACE inhibitory substances derived from soy foods | LYY | LYY | 3 | soy protein ( Natto) | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | B.subtilis Natto + protease (end-type neutral protease, PROTIN SD-NY10) | protease | NA | NA | NA | NA |
| FMDB912 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LHLPLP | LHLPLP | 6 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | SHR | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5727 | NA | HPLC-MS | 345.4 +2 | 688.4 | 5.5±0.4uM |
| FMDB913 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LHLPLPL | LHLPLPL | 7 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | SHR | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5727 | NA | HPLC-MS | 401.9 +2 | 801.5 | 425±44uM |
| FMDB914 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LVYPFPGPIPNSLPQNIPP | LVYPFPGPIPNSLPQNIPP | 19 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5727 | NA | HPLC-MS | 2060.0 +1 | 2059.4 | 5.27±0.3uM |
| FMDB915 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VLGPVRGPFP | VLGPVRGPFP | 10 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5727 | NA | HPLC-MS | 520.0 +2 | 1037.6 | 137±6uM |
| FMDB916 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VRGPFPIIV | VRGPFPIIV | 9 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5727 | NA | HPLC-MS | 499.5 +2 | 996.6 | 599±55uM |
| FMDB917 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VLGPVRGPFPIIV | VLGPVRGPFPIIV | 13 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5727 | NA | HPLC-MS | 682.7 +2 | 1362.7 | >700uM |
| FMDB918 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LTQTPVVVPPF | LTQTPVVVPPF | 11 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5727 | NA | HPLC-MS | 1197.4 +1 | 1196.6 | >1500uM |
| FMDB919 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VVVPPF | VVVPPF | 6 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5727 | NA | HPLC-MS | 329.3 +2 | 656.3 | >1500uM |
| FMDB920 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LHLPLP | LHLPLP | 6 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5728 | NA | HPLC-MS | 345.4 +2 | 688.4 | 5.5±0.4uM |
| FMDB921 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LHLPLPL | LHLPLPL | 7 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5728 | NA | HPLC-MS | 401.9 +2 | 801.5 | 425±44uM |
| FMDB922 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LVYPFPGPIPNSLPQNIPP | LVYPFPGPIPNSLPQNIPP | 19 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5728 | NA | HPLC-MS | 2060.0 +1 | 2059.4 | 5.27±0.3uM |
| FMDB923 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VLGPVRGPFP | VLGPVRGPFP | 10 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5728 | NA | HPLC-MS | 520.0 +2 | 1037.6 | 137±6uM |
| FMDB924 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VRGPFPIIV | VRGPFPIIV | 9 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5728 | NA | HPLC-MS | 499.5 +2 | 996.6 | 599±55uM |
| FMDB925 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VLGPVRGPFPIIV | VLGPVRGPFPIIV | 13 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5728 | NA | HPLC-MS | 682.7 +2 | 1362.7 | >700uM |
| FMDB926 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LTQTPVVVPPF | LTQTPVVVPPF | 11 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5728 | NA | HPLC-MS | 1197.4 +1 | 1196.6 | >1500uM |
| FMDB927 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VVVPPF | VVVPPF | 6 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5728 | NA | HPLC-MS | 329.3 +2 | 656.3 | >1500uM |
| FMDB928 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LHLPLP | LHLPLP | 6 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5826 | NA | HPLC-MS | 345.4 +2 | 688.4 | 5.5±0.4uM |
| FMDB929 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LHLPLPL | LHLPLPL | 7 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5826 | NA | HPLC-MS | 401.9 +2 | 801.5 | 425±44uM |
| FMDB930 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LVYPFPGPIPNSLPQNIPP | LVYPFPGPIPNSLPQNIPP | 19 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5826 | NA | HPLC-MS | 2060.0 +1 | 2059.4 | 5.27±0.3uM |
| FMDB931 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VLGPVRGPFP | VLGPVRGPFP | 10 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5826 | NA | HPLC-MS | 520.0 +2 | 1037.6 | 137±6uM |
| FMDB932 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VRGPFPIIV | VRGPFPIIV | 9 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5826 | NA | HPLC-MS | 499.5 +2 | 996.6 | 599±55uM |
| FMDB933 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VLGPVRGPFPIIV | VLGPVRGPFPIIV | 13 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5826 | NA | HPLC-MS | 682.7 +2 | 1362.7 | >700uM |
| FMDB934 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LTQTPVVVPPF | LTQTPVVVPPF | 11 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5826 | NA | HPLC-MS | 1197.4 +1 | 1196.6 | >1500uM |
| FMDB935 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VVVPPF | VVVPPF | 6 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5826 | NA | HPLC-MS | 329.3 +2 | 656.3 | >1500uM |
| FMDB936 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LHLPLP | LHLPLP | 6 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5827 | NA | HPLC-MS | 345.4 +2 | 688.4 | 5.5±0.4uM |
| FMDB937 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LHLPLPL | LHLPLPL | 7 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5827 | NA | HPLC-MS | 401.9 +2 | 801.5 | 425±44uM |
| FMDB938 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LVYPFPGPIPNSLPQNIPP | LVYPFPGPIPNSLPQNIPP | 19 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5827 | NA | HPLC-MS | 2060.0 +1 | 2059.4 | 5.27±0.3uM |
| FMDB939 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VLGPVRGPFP | VLGPVRGPFP | 10 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5827 | NA | HPLC-MS | 520.0 +2 | 1037.6 | 137±6uM |
| FMDB940 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VRGPFPIIV | VRGPFPIIV | 9 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5827 | NA | HPLC-MS | 499.5 +2 | 996.6 | 599±55uM |
| FMDB941 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VLGPVRGPFPIIV | VLGPVRGPFPIIV | 13 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5827 | NA | HPLC-MS | 682.7 +2 | 1362.7 | >700uM |
| FMDB942 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LTQTPVVVPPF | LTQTPVVVPPF | 11 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5827 | NA | HPLC-MS | 1197.4 +1 | 1196.6 | >1500uM |
| FMDB943 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VVVPPF | VVVPPF | 6 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5827 | NA | HPLC-MS | 329.3 +2 | 656.3 | >1500uM |
| FMDB1014 | 22450789 | NA | NA | QFYAV | QFYAV | 5 | Korean trad. Rice wine | NA | NA | NA | NA | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Nuruk as starter | NA | LC-MS/MS | NA | 468.7 Da | 0.34mg/ml |
| FMDB1015 | 22450789 | NA | NA | AGPVLL | AGPVLL | 6 | Korean trad. Rice wine | NA | NA | NA | NA | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Nuruk as starter | NA | LC-MS/MS | NA | 357.7 Da | 1.23mg/ml |
| FMDB1283 | NA | kajimoto02 | Hypotensive effects of tablets containing “lactotripeptides (VPP, IPP)” | IPP | IPP | 3 | Yogurt | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | L. helveticus and S. cerevisiae | Proteinase | NA | NA | NA | 5 micro mol /l |
| FMDB1284 | NA | kajimoto02 | Hypotensive effects of tablets containing “lactotripeptides (VPP, IPP)” | IPP | IPP | 3 | Yogurt | k-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | L. helveticus and S. cerevisiae | Proteinase | NA | NA | NA | 5 micro mol /l |
| FMDB1285 | NA | kajimoto02 | Hypotensive effects of tablets containing “lactotripeptides (VPP, IPP)” | VPP | VPP | 3 | Yogurt | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | L. helveticus and S. cerevisiae | Proteinase | NA | NA | NA | 9micromol/l |
| FMDB1819 | 15328207 | NA | Structural Analysis of a New Anti-Hypertensive Peptide (β-Lactosin B) Isolated from a Commercial Whey Product | ALPM “β-lactosin B” | ALPM | 5 | commercial Whey product, WE80BG | β-lactoglobulin | NA | NA | NA | Anti-hypertensive | In vivo | NA | NA | NA | NA | RPHPLC and N terminal sequencing by Edman degradation | NA | NA | 928uM |
| FMDB1906 | NA | tsai08 | Antihypertensive effect of bioactive peptides produced by protease-facilitated lactic acid fermentation of Milk | YPYY | YPYY | 4 | Fermented Milk Whey product (4.5% (w/v) skimmed Milk powder, 5.5% (w/v) whole Milk powder and 7% (w/v) sucrose ) | Casein | NA | 43c | 5h | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | Streptococcus thermophilus and Lactobacillus bulgaricus + . Flavourzyme from Aspergillus oryzae | protease | RP-HPLC and protein sequencer 492 Procise | NA | NA | 90.9uM |
| FMDB1974 | 19619856 | NA | NA | IPP | IPP | 3 | Casein miso paste (sodium Caseinate (24%: w/w), rice koji (20.9%: w/w), salt (10.8%: w/w), S.cerevisiae (0.1%: w/w) and water (3.1%: w/w) | Casein | NA | 30c | 7days | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | A.oryzae in rice koji +Saccharomyces cerevisiae | proteinase and peptidase | LC-MS | NA | NA | NA |
| FMDB1975 | 19619856 | NA | NA | VPP | VPP | 3 | Casein miso paste (sodium Caseinate (24%: w/w), rice koji (20.9%: w/w), salt (10.8%: w/w), S.cerevisiae (0.1%: w/w) and water (3.1%: w/w) | Casein | NA | 30c | 7days | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | A.oryzae in rice koji +Saccharomyces cerevisiae | proteinase and peptidase | LC-MS | NA | NA | NA |
| FMDB1979 | 12843654 | NA | NA | VLSLSQPKVLPVPQKAVPQ | VLSLSQPKVLPVPQKAVPQ | 19 | Skim Milk | β-Casein | NA | 38C | 20h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus acidophilus, Lactobacillus helveticus and Saccharomyces cerevisiae | NA | MALDITOF-MS | 2029.4893 | NA | NA |
| FMDB1980 | 12358510 | NA | NA | VY | VY | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 35.2uM |
| FMDB1981 | 12358510 | NA | NA | IY | IY | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 6.1uM |
| FMDB1982 | 12358510 | NA | NA | AW | AW | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 18.8uM |
| FMDB1983 | 12358510 | NA | NA | FY | FY | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 42.3uM |
| FMDB1984 | 12358510 | NA | NA | VW | VW | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 3.3uM |
| FMDB1985 | 12358510 | NA | NA | IW | IW | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 1.5uM |
| FMDB1986 | 12358510 | NA | NA | LW | LW | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 23.6uM |
| FMDB1994 | 19994857 | NA | NA | AW | AW | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 10 microM |
| FMDB1995 | 19994857 | NA | NA | GW | GW | 2 | Fermented soyabean seasoning | NA | NA | 26 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 30 microM |
| FMDB1996 | 19994857 | NA | NA | AY | AY | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 48 microM |
| FMDB1997 | 19994857 | NA | NA | SY | SY | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 67 microM |
| FMDB1998 | 19994857 | NA | NA | GY | GY | 2 | Fermented soyabean seasoning | NA | NA | NA | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 97 microM |
| FMDB1999 | 19994857 | NA | NA | AF | AF | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 190 microM |
| FMDB2000 | 19994857 | NA | NA | VP | VP | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 480 microM |
| FMDB2001 | 19994857 | NA | NA | AI | AI | 2 | Fermented soyabean seasoning | NA | NA | NA | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 690 microM |
| FMDB2002 | 19994857 | NA | NA | VG | VG | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 1100 microM |
| FMDB2003 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 7.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60208 or H9) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2004 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 7.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60208 or H9) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2005 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30046) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2006 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30046) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2007 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 34.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60205) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2008 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 32.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU10142) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2009 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 32.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU10142) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2010 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 15.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30005) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2011 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 15.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30005) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2012 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60207) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2013 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60207) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2014 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60210) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2015 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60210) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2016 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60211) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2017 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60211) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2018 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60204) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2019 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60204) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2020 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50010) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2021 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60201) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2022 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60201) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2023 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 24.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60220) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2024 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60066) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2025 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60066) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2026 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.2h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60212) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2027 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.2h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60212) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2028 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50151) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2029 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50151) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2030 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60117) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2031 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60117) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2032 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30003) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2033 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30003) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2034 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 23h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30023) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2035 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 42.4h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50061) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2036 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30134) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2037 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30134) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2038 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 14.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60206) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2039 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 14.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60206) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2040 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50011) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2177 | 15978996 | NA | Angiotensin I converting enzyme (ACE) inhibitory peptide derived from the sauce of fermented blue mussel, Mytilus edulis | EVMAGNLYPG | EVMAGNLYPG | 10 | fermented blue mussel sauce | NA | NA | 20C | NA | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | NA | NA | NA | LC-MS/MS | NA | NA | 19.34 μg/ml |