Browse result page of FermFooDB Database

This is the result page of browse. This page gives the information about peptides returned against the selected category. Further details of the peptide can be seen by clicking on the FMDB_ID. Further the user can sort the peptides on the basis of various fields by clicking on the respective headers.

The total number entries retrieved from this search are 40

FMDB_IDPubMed IDReferenceTitlePeptide_SequenceSequenceLength of peptideFood_Matrix Protein pHTemperatureIncubation TimeActivityExperimentModelAssay for Activity MeasurementCultureHydrolysisMethod of analysisM_Z ratioMassIC50
FMDB16926996626; 10434050NANAVYQHQKAMKPWIQPKTKVIPYVRYLVYQHQKAMKPWIQPKTKVIPYVRYL25MilkαS2-Casein3.83 ± 0.241c48hAntibacterialNANANALactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extractproteinases and peptidases of lactobacillusMALDI-TOF/MS/MS3115.4 NANA
FMDB17026996626; 10434050NANAVYQHQKAMKPWIQPKTKVIPYVRYLVYQHQKAMKPWIQPKTKVIPYVRYL25MilkαS2-Casein4.27 ± 0.1541c48hAntibacterialNANANALactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extractproteinases and peptidases of lactobacillusMALDI-TOF/MS/MS3115.4 NANA
FMDB17126996626; 10434050NANAVYQHQKAMKPWIQPKTKVIPYVRYLVYQHQKAMKPWIQPKTKVIPYVRYL25MilkαS2-Casein4.32 ± 0.641c48hAntibacterialNANANALactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extractproteinases and peptidases of lactobacillusMALDI-TOF/MS/MS3115.4 NANA
FMDB17226996626; 10434050NANAVYQHQKAMKPWIQPKTKVIPYVRYLVYQHQKAMKPWIQPKTKVIPYVRYL25MilkαS2-Casein4.39± 0.2241c48hAntibacterialNANANALactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extractproteinases and peptidases of lactobacillusMALDI-TOF/MS/MS3115.4 NANA
FMDB28022103626;11694622NANAYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17Bovine sodium Caseinateβ-CaseinNA42C4hImmunomodulatory;AntibacterialNANANAS.thermophilus 4F44proteinase and peptidaseLC-ESI-MS/MS.NA NANA
FMDB28122103626;11694622NANAYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17Bovine sodium Caseinateβ-CaseinNA42C4hImmunomodulatory;AntibacterialNANANAS.thermophilus ATE 19 PB8proteinase and peptidaseLC-ESI-MS/MS.NA NANA
FMDB28222103626;11694622NANAYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17Bovine sodium Caseinateβ-CaseinNA42C4hImmunomodulatory;AntibacterialNANANAS.thermophilus Y4proteinase and peptidaseLC-ESI-MS/MS.NA NANA
FMDB28322103626;11694622NANAYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17Bovine sodium Caseinateβ-CaseinNA42C4hImmunomodulatory;AntibacterialNANANAS.thermophilus LMD-9proteinase and peptidaseLC-ESI-MS/MS.NA NANA
FMDB28422103626;11694622NANAYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17Bovine sodium Caseinateβ-CaseinNA42C4hImmunomodulatory;AntibacterialNANANAS.thermophilus PB302proteinase and peptidaseLC-ESI-MS/MS.NA NANA
FMDB28522103626;11694622NANAYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17Bovine sodium Caseinateβ-CaseinNA42C4hImmunomodulatory;AntibacterialNANANAS.thermophilus PB385proteinase and peptidaseLC-ESI-MS/MS.NA NANA
FMDB28622103626;11694622NANAYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17Bovine sodium Caseinateβ-CaseinNA42C4hImmunomodulatory;AntibacterialNANANAS.thermophilus CNRZ 404proteinase and peptidaseLC-ESI-MS/MS.NA NANA
FMDB28722103626;11694622NANAYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17Bovine sodium Caseinateβ-CaseinNA42C4hImmunomodulatory;AntibacterialNANANAS.thermophilus CNRZ445proteinase and peptidaseLC-ESI-MS/MS.NA NANA
FMDB28822103626;11694622NANAYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17Bovine sodium Caseinateβ-CaseinNA42C4hImmunomodulatory;AntibacterialNANANAS.thermophilus ATCC19258proteinase and peptidaseLC-ESI-MS/MS.NA NANA
FMDB28922103626;11694622NANAYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17Bovine sodium Caseinateβ-CaseinNA42C4hImmunomodulatory;AntibacterialNANANAS.thermophilus HAD 8αproteinase and peptidaseLC-ESI-MS/MS.NA NANA
FMDB33322103626;8603791NANARPKHPIKHQGLPQEVLNENLLRFRPKHPIKHQGLPQEVLNENLLRF23Bovine sodium CaseinateαS1-CaseinNA42C4hImmunomodulatory;AntibacterialNANANAS.thermophilus LMD-9proteinase and peptidaseLC-ESI-MS/MS.NA NANA
FMDB33422103626;8603791NANARPKHPIKHQGLPQEVLNENLLRFRPKHPIKHQGLPQEVLNENLLRF23Bovine sodium CaseinateαS1-CaseinNA42C4hImmunomodulatory;AntibacterialNANANAS.thermophilus PB385proteinase and peptidaseLC-ESI-MS/MS.NA NANA
FMDB33522103626;8603791NANARPKHPIKHQGLPQEVLNENLLRFRPKHPIKHQGLPQEVLNENLLRF23Bovine sodium CaseinateαS1-CaseinNA42C4hImmunomodulatory;AntibacterialNANANAS.thermophilus 4F44proteinase and peptidaseLC-ESI-MS/MS.NA NANA
FMDB33622103626;8603791NANARPKHPIKHQGLPQEVLNENLLRFRPKHPIKHQGLPQEVLNENLLRF23Bovine sodium CaseinateαS1-CaseinNA42C4hImmunomodulatory;AntibacterialNANANAS.thermophilus Y4proteinase and peptidaseLC-ESI-MS/MS.NA NANA
FMDB1648Rizello 2005Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesGLSPEVLNENLLGLSPEVLNENLL12WSE of Pecorino Romano cheeseSheep αS1- Casein5.345-46C cooking ; ripenin 10mo10montholdAntibacterialIn vitroNANAnatural culture in scottaproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 1297.6NA
FMDB1649NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesRFVVAPFPERFVVAPFPE9WSE of Pecorino Romano cheeseSheep αS1-Casein5.345-46C cooking ; ripenin 10mo10montholdAntibacterialIn vitroNANAnatural culture in scottaproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 1061.7NA
FMDB1650NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesVVAPFPEVVVAPFPEV8WSE of Pecorino Romano cheeseSheep αS1-Casein5.345-46C cooking ; ripenin 10mo10montholdAntibacterialIn vitroNANAnatural culture in scottaproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 857.5NA
FMDB1651NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesVMFPPQSVLVMFPPQSVL9WSE of Pecorino Romano cheeseSheep β-Casein5.345-46C cooking ; ripenin 10mo10montholdAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4natural culture in scottaproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 1017.4NA
FMDB1652NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesMAIPPKKNQDMAIPPKKNQD10WSE of Canestrato Pugliese cheeseCow k-Casein5NA6month old ripeningAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4natural Whey cultureproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 1141.5NA
FMDB1653NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesTVQVTSTAVTVQVTSTAV9WSE of Canestrato Pugliese cheeseCow k-Casein5NA6month old ripeningAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4natural Whey cultureproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 905.3NA
FMDB1654NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesMPIQAFMPIQAF6WSE of Canestrato PuglieseSheep β-Casein5NA6month old ripeningAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4natural Whey cultureproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 706.4NA
FMDB1655NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesFVAPFPEVFGFVAPFPEVFG10WSE of Canestrato Pugliesecow αS1-Casein5NA6month old ripeningAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4natural Whey cultureproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 1109.5NA
FMDB1656NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesGKEKVNELSKDGKEKVNELSKD11WSE of Canestrato Pugliese cheesecow αS1-Casein5NA6month old ripeningAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4natural Whey cultureproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 1246.7NA
FMDB1657NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesFVAPFPEVFGFVAPFPEVFG10WSE of Canestrato Pugliese cheesecow αS1-Casein5NA6month old ripeningAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4natural Whey cultureproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 1109.5NA
FMDB1658NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesRPKHPIKRPKHPIK7WSE of Caciocavallocow αS1-Casein5.2stretching at 90-95C3 monthold ripeningAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4natural Milk cultureproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 875.6NA
FMDB1659NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesGLPQEGLPQE5WSE of Caciocavallo cheesecow αS1-Casein5.2stretching at 90-95C4 monthold ripeningAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4natural Milk cultureproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 543.1NA
FMDB1660NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesMAIPPKKNQDMAIPPKKNQD10WSE of Crescenza cheeseCow k-Casein5.6NA7days ripeningAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4freeze dried cultureproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 1141.5NA
FMDB1661NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesYQEPVLGPVRGPFPIIVYQEPVLGPVRGPFPIIV17WSE of CrescenzaCow β-Casein5.6NA7days ripeningAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4freeze dried cultureproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 1881.3NA
FMDB1662NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesMPIQAFLLMPIQAFLL8WSE of Crescenza cheeseCow β-Casein5.6NA7days ripeningAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4freeze dried cultureproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 932.5NA
FMDB1663NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesFVAPFPEVFGFVAPFPEVFG10WSE of Crescenza cheesecow αS1-Casein5.6NA7days ripeningAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4freeze dried cultureproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 1109.4NA
FMDB1664NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesFVAPFPEVFFVAPFPEVF9WSE of Crescenza cheesecow αS1-Casein5.6NA7days ripeningAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4freeze dried cultureproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 1052.7NA
FMDB1665NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesYPFTGPIPNYPFTGPIPN9WSE of Caprino del piemonte cheeseGoat β-Casein4.7NA30days ripeningAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4NAproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 1005.5NA
FMDB1666NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesMPIQAMPIQA5WSE of Caprino del piemonteGoat β-Casein4.7NA30days ripeningAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4NAproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 559.2NA
FMDB1667NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesVFMFPPQSVVFMFPPQSV9WSE of Caprino del piemonte cheeseGoat β-Casein4.7NA30days ripeningAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4NAproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 904.4NA
FMDB1668NAAntibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese VarietiesVVAPFPEVVAPFPE7WSE of Caprino del piemonte cheeseGoat αS1-Casein4.7NA30days ripeningAntibacterialIn vitroNAWell diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4NAproteolytic enzymeHPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS)NA 758.4NA
FMDB208212957917NANAQELLLNPTHQYPVTQPLAPVHNPISVQELLLNPTHQYPVTQPLAPVHNPISV26Human Milk sodium Caseinateβ-Casein4.637c48hAntibacterial against Enterococcus faecium;Bacillus megaterium;Escherichia coli;Listeria innocua;Salmonella spp.;Yersinia enterocolitica;;Staphylococcus aureusIn vitroNAwell diffusion assayProteinase of L.helveticus PR4proteinaseMALDITOF-MSNA 3132.8NA