| 1042 | ISP region (Mutant D105) | EVVLQNRRGLDLLTAEQGGICLALQEKCCFYANKS | 35 | L | None | None | None | Linear | Protein Derived | Within the transmembrane (TM) protein of Mason-Pfizer monkey virus | T-cell and B-cell | Immunosuppressive effect on both T-cell and B-cell mitogenic response | In vitro | HeLa, COS-1, CV-1and BHK cells | NA | NA | NA | NA | NA | 1316462 | 1992 |
| 1043 | ISP region (Mutant D33) | LQNRRGLDLLT | 11 | L | None | None | None | Linear | Protein Derived | Within the transmembrane (TM) protein of Mason-Pfizer monkey virus | T-cell and B-cell | Immunosuppressive effect on both T-cell and B-cell mitogenic response | In vitro | HeLa, COS-1, CV-1and BHK cells | NA | NA | NA | NA | NA | 1316462 | 1992 |
| 1268 | NA | CVCVCLLPRYPSAGVFTYLNTKIITFDSVLSCA | 33 | L | None | None | None | Linear | Protein Derived | Amino acid sequences derived from a human native nucleotide sequence capable of expressing GIF (glycosylation-inhibiting factors) | B-cells | Glycosylation inhibiting factor activity causing the suppression of immunoglobulin E (IgE) production | In vitro | Mesenteric lymph node (MLN) cells | NA | Lewis Rat | Rosette inhibition assay, tests of the IgE-SF activity | NA | NA | EP 0255394 A2 | 1987 |
| 1371 | A2.94-112 | TLQRMYGCDVGSDWRFLRG | 19 | L | None | None | None | Linear | Protein Derived | α2 domain of HLA-A2 | B-Lymphoblastoid cells (B-cell) | Inhibit by binding to variable T cell receptor | In vitro | AJY CTL cell line | NA | None | Hummoral Immune Response assay | NA | NA | US 5888512 | 1999 |
| 1372 | A2.98-113 | MYGCDVGSDWRFLRGY | 16 | L | None | None | None | Linear | Protein Derived | α2 domain of HLA-A2 | B-Lymphoblastoid cells (B-cell) | Inhibit by binding to variable T cell receptor | In vitro | AJY CTL cell line | NA | None | Hummoral Immune Response assay | NA | NA | US 5888512 | 1999 |
| 1373 | A2.101-108 | CDVGSDWR | 8 | L | None | None | None | Linear | Protein Derived | α2 domain of HLA-A2 | B-Lymphoblastoid cells (B-cell) | Inhibit by binding to variable T cell receptor | In vitro | JY cells (HKA-A2, B7, DR4,6) | NA | None | Hummoral Immune Response assay | NA | NA | US 5888512 | 1999 |
