1071 | Cycloamanide C | LPMLGFLV | 8 | L | None | None | R and S sulfoxide on methionine | Cyclic | Natural | Isolated from the mushroom Amanita phalloides | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
1072 | Cycloamanide D | LPMLGFLP | 8 | L | None | None | R and S sulfoxide on methionine | Cyclic | Natural | Isolated from the mushroom Amanita phalloides | NA | Not investigated | Both | SRBC (sheep red blood cells) | NA | CBA/Iiw mice 8-10 weeks | Humoral immune response test,PFC (plaque froming cell) test, DTH (delayed type hypersensitivity) test | NA | NA | 8441706 | 1992 |
1121 | Charybdotoxin (Venom peptide) | XFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS | 37 | L | None | None | X=PyroGlutamic acid | Linear | Natural | Leiurus quinquestriatus hebraeus (scorpion) | K+ (potassium) channel | Potassium channel blocker | In vitro | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1125 | Iberiotoxin (Venom peptide) | XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ | 37 | L | None | None | X=Pyroglutamic acid and disulfile linkage at Disulfide bridges: Cys7 - Cys28, Cys13 - Cys33, Cys17 - Cys35 | Linear | Natural | Buthus tamulus (scorpion) | Blocker of several BK channels | Bloackion channels | Both | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1202 | A1HS1 | II-Sta-PYVPL | 8 | L | None | None | Sta = (3S, 4S) -4- amino-3-hydroxy-6-methyl-heptanoic acid(C8H17NO3) | Cyclic | Synthetic | NA | Lymphocytes, Macrophages | Influence of phagocytic function of macrophages, and the retarding effect of the proliferation of Lymphocytes | Both | Spleen Lymphocyte | NA | BALB / C mice | Delayed-type hypersensitivity (DTH) test, Lymphocyte Proliferation test, MTT | NA | | CN 101289499 B | 2010 |
1212 | SEQ ID NO: 1 | ILAKFLHWL | 9 | L | None | None | Inventors midified C- or at the N-terminus of the peptides with stabilizing groups, groups for increasing the water solubility, luminescent markers, fluorescent markers, radioactive markers, metal markers, polymeric markers, antibodies, enzymes, epitope tags, amino acid, D- or L-amino acids, serine, glycine, aspartate, sugar groups, glucuronic acid, sulfate moieties and polyethylene glycol. for experiments | Linear | Protein Derived | human telomerase reverse transcriptase | Proteasome | Inhibits the overall activity of the proteasome | In vitro | HeLa, Saos | NA | NA | NA | NA | | DE 102006025146 A1 | 2007 |
1359 | CDP1 | GPRGP(HP)GP(HP)GPAGL(HP)GPK | 18 | L | None | None | HP = Hydroxyproline | Linear | Protein Derived | Collagen derived | Bystander antigens | By releasing transforming growth factor β (TGF-β) | In vivo | None | NA | Rats | NA | NA | NA | US 5399347 | 1995 |
1360 | CDP2 | GE(HP)GA(HP)GPAGP(HP)GE(HP)GA(HP)GPAG | 22 | L | None | None | HP = Hydroxyproline | Linear | Protein Derived | Collagen derived | Bystander antigens | By releasing transforming growth factor β (TGF-β) | In vivo | None | NA | Rats | NA | NA | NA | US 5399347 | 1995 |
1361 | CDP3 | GEEGLRGARGE(HP)GERGP(HP)GPQGAR | 24 | L | None | None | HP = Hydroxyproline | Linear | Protein Derived | Collagen derived | Bystander antigens | By releasing transforming growth factor β (TGF-β) | In vivo | None | NA | Rats | NA | NA | NA | US 5399347 | 1995 |
1362 | CDP2 | GE(HP)GA(HP)GPAGP(HP)GE(HP)GA(HP)GpAGp(HP)G | 25 | Mix | None | None | HP = Hydroxyproline | Linear | Protein Derived | Collagen derived | Bystander antigens | By releasing transforming growth factor β (TGF-β) | In vivo | None | NA | Rats | NA | NA | NA | US 5720955 | 1998 |
1363 | CDP3 | GEEGLRGARGE(HP)GERGP(HP)GPQGA | 23 | L | None | None | HP = Hydroxyproline | Linear | Protein Derived | Collagen derived | Bystander antigens | By releasing transforming growth factor β (TGF-β) | In vivo | None | NA | Rats | NA | NA | NA | US 5720955 | 1998 |
1365 | CDP2 | GE(HP)GA(HP)GPAGP(HP)GE(HP)GA(HP)GPAGP(HP)G | 25 | L | None | None | HP = Hydroxyproline | Linear | Protein Derived | Collagen derived | Bystander antigens | By releasing transforming growth factor β (TGF-β) | In vivo | None | NA | Rats | NA | NA | NA | US 5783188 | 1998 |
1366 | CDP3 | GEEGLRGARGE(HP)GERGP(HP)GPQGAR | 24 | L | None | None | HP = Hydroxyproline | Linear | Protein Derived | Collagen derived | Bystander antigens | By releasing transforming growth factor β (TGF-β) | In vivo | None | NA | Rats | NA | NA | NA | US 5783188 | 1998 |
1368 | CDP2 | GE(HP)GA(HP)GPAGP(HP)GE(HP)GA(HP)GPAGP(HP)G | 25 | L | None | None | HP = Hydroxyproline | Linear | Protein Derived | Collagen derived | Bystander antigens | By releasing transforming growth factor β (TGF-β) | In vivo | None | NA | Rats | NA | NA | NA | US 5843445 | 1998 |
1369 | CDP3 | GEEGLRGARGE(HP)GERGP(HP)GPQGAR | 24 | L | None | None | HP = Hydroxyproline | Linear | Protein Derived | Collagen derived | Bystander antigens | By releasing transforming growth factor β (TGF-β) | In vivo | None | NA | Rats | NA | NA | NA | US 5843445 | 1998 |
1381 | SEQ ID8 | RSCIDTIPKSRCTAFQCKHSMKXYRLSFCRKTCGTC | 36 | L | None | None | X = cyclohexylalanine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1382 | SEQ ID9 | RSCIDTIPKSRCTAFQCKHSMAYRLSXCRKTCGTC | 35 | L | None | None | X = cyclohexylalanine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1392 | SEQ ID19 | RSCIDTIPKSQCTAFQCKHSXKYRLSFCRKTCGTC | 35 | L | None | None | X = norleucine (nL) | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1394 | SEQ ID21 | RSCIDTIPKSRCTAFQCKHSMXYRLSFCRKTCGTC | 35 | L | None | None | X = norleucine (nL) | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1395 | SEQ ID22 | RSCIDTIPKSRCTAFQCKHSMXYRLSFCRKTCGTC | 35 | L | None | None | X = ornithine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1396 | SEQ ID23 | RSCIDTIPKSRCTAFQCKHSMXYRLSFCRKTCGTC | 35 | L | None | None | X = homocitrulline | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1399 | SEQ ID26 | RSCIDTIPKSRCTAFQCKHSMKXRLSFCRKTCGTC | 35 | L | None | None | X = nitrophenylalanine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1400 | SEQ ID27 | RSCIDTIPKSRCTAFQCKHSMKXRLSFCRKTCGTC | 35 | L | None | None | X = aminophenylalanine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1429 | SEQ ID56 | RSCIDTIPKSRCTAFQCKHSMXYRLSFCRKTCGTC | 35 | L | None | None | X = diaminopropanoic acid | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1430 | SEQ ID57 | RSCIDTIPKSRCTAFQCKHSMKXRLSFCRKTCGTC | 35 | L | None | None | X = benzoylphenylalanine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1431 | SEQ ID58 | XSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | X = N-acetyl-arginine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1432 | SEQ ID59 | RSCIDTIPKSRCTAXQCKHSMKYRLSFCRKTCGTC | 35 | L | None | None | X = azidophenylalanine | Linear | Natural | Shk toxin of S.helianthus | T Lymphocytes Kv1.3 channels | By blocking the potassium channel, Kv1.3 of T lymphocytes | Both | Peripheral blood human lymhocytes | 1 nM | CD18-nullPL/J mice | Enzyme-linked immunosorbent assay (ELISA), HPLC | NA | Charybdotoxin (ChTX) | US 6077680 | 2000 |
1494 | Glandular kallikrein (K1) | VVGGYNXEMNSQPWQVAVYYFGEYLX | 26 | L | None | None | X = not mentioned | Linear | Natural | Submandibular glands of rat | Native bovine type II collagen | By regulation function of Glandular Kallikrein | In vivo | None | NA | Sprague Dawley rats | Hummoral Immune Response assay | NA | NA | US 7195759 B2 | 2007 |