A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10012
Swiss-prot Accession number	P17685 (Sequence in FASTA format)
Description	ELH type 1 precursor [Contains: Alpha-bag cell peptide (Alpha-BCP);Beta-bag cell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP);Egg-laying hormone (ELH); Acidic peptide].
Source organism	Aplysia parvula (Little sea hare)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	Bag cell neurons
Post translational modification	N/A
Function	N/A
Protein Length	263 Amino acids
Molecular weight	29676
References	1  PubMed abstract 3734873
Domain Name	ELH
Hormone Name	Gamma-bag cell peptide
Mature Hormone Sequence	RIRFN
Position of mature hormone in Pre-Hormone protein	5 Residues from position (95-99)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10107
Swiss-prot Accession number	P01362 (Sequence in FASTA format)
Description	ELH precursor [Contains: Alpha-bag cell peptide (Alpha-BCP); Beta-bagcell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP); Egg-laying hormone (ELH); Acidic peptide].
Source organism	Aplysia californica (California sea hare)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	Bag cell neurons
Post translational modification	N/A
Function	N/A
Protein Length	271 Amino acids
Molecular weight	30827
References	1  PubMed abstract 6687446 2  PubMed abstract 16593372 3  PubMed abstract 293751 4  PubMed abstract 3549995
Domain Name	ELH
Hormone Name	Gamma-bag cell peptide
Mature Hormone Sequence	RLRFD
Position of mature hormone in Pre-Hormone protein	5 Residues from position (103-107)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10412
Swiss-prot Accession number	P06308 (Sequence in FASTA format)
Description	Ovulation prohormone precursor [Contains: Beta-3-CDCP; Beta-2-CDCP;Beta-1-CDCP; Calfluxin; Alpha-CDCP; Ovulation hormone (Cerebralneurosecretory caudodorsal cell hormone) (CDCH); X-CDCP].
Source organism	Lymnaea stagnalis (Great pond snail)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Pulmonata; Basommatophora;Lymnaeoidea; Lymnaeidae; Lymnaea.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	259 Amino acids
Molecular weight	29613
References	1  PubMed abstract 3183719 2  PubMed abstract 16578788
Domain Name	ELH
Hormone Name	Beta-2-CDCP
Mature Hormone Sequence	RLRAS
Position of mature hormone in Pre-Hormone protein	5 Residues from position (112-116)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10604
Swiss-prot Accession number	P01362 (Sequence in FASTA format)
Description	ELH precursor [Contains: Alpha-bag cell peptide (Alpha-BCP); Beta-bagcell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP); Egg-laying hormone (ELH); Acidic peptide].
Source organism	Aplysia californica (California sea hare)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	Bag cell neurons
Post translational modification	N/A
Function	Beta-BCP specifically excites 2 neurons, L1 and R1, in the abdominal ganglion
Protein Length	271 Amino acids
Molecular weight	30827
References	1  PubMed abstract 6687446 2  PubMed abstract 16593372 3  PubMed abstract 293751 4  PubMed abstract 3549995
Domain Name	ELH
Hormone Name	Beta-bag cell peptide
Mature Hormone Sequence	RLRFH
Position of mature hormone in Pre-Hormone protein	5 Residues from position (96-100)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10605
Swiss-prot Accession number	P01362 (Sequence in FASTA format)
Description	ELH precursor [Contains: Alpha-bag cell peptide (Alpha-BCP); Beta-bagcell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP); Egg-laying hormone (ELH); Acidic peptide].
Source organism	Aplysia californica (California sea hare)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	Bag cell neurons
Post translational modification	N/A
Function	N/A
Protein Length	271 Amino acids
Molecular weight	30827
References	1  PubMed abstract 6687446 2  PubMed abstract 16593372 3  PubMed abstract 293751 4  PubMed abstract 3549995
Domain Name	ELH
Hormone Name	Gamma-delta-bag cell peptide
Mature Hormone Sequence	RLRFDRRDQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDL
Position of mature hormone in Pre-Hormone protein	46 Residues from position (103-148)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10606
Swiss-prot Accession number	P01362 (Sequence in FASTA format)
Description	ELH precursor [Contains: Alpha-bag cell peptide (Alpha-BCP); Beta-bagcell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP); Egg-laying hormone (ELH); Acidic peptide].
Source organism	Aplysia californica (California sea hare)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	Bag cell neurons
Post translational modification	N/A
Function	N/A
Protein Length	271 Amino acids
Molecular weight	30827
References	1  PubMed abstract 6687446 2  PubMed abstract 16593372 3  PubMed abstract 293751 4  PubMed abstract 3549995
Domain Name	ELH
Hormone Name	Delta-bag cell peptide
Mature Hormone Sequence	DQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDL
Position of mature hormone in Pre-Hormone protein	39 Residues from position (110-148)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10607
Swiss-prot Accession number	P01362 (Sequence in FASTA format)
Description	ELH precursor [Contains: Alpha-bag cell peptide (Alpha-BCP); Beta-bagcell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP); Egg-laying hormone (ELH); Acidic peptide].
Source organism	Aplysia californica (California sea hare)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	Bag cell neurons
Post translational modification	N/A
Function	Alpha-BCP decreases the activity of a cluster of neurons in the left upper quadrant of the abdominal ganglion
Protein Length	271 Amino acids
Molecular weight	30827
References	1  PubMed abstract 6687446 2  PubMed abstract 16593372 3  PubMed abstract 293751 4  PubMed abstract 3549995
Domain Name	ELH
Hormone Name	Alpha-bag cell peptide
Mature Hormone Sequence	APRLRFYSL
Position of mature hormone in Pre-Hormone protein	9 Residues from position (150-158)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	10608
Swiss-prot Accession number	P01362 (Sequence in FASTA format)
Description	ELH precursor [Contains: Alpha-bag cell peptide (Alpha-BCP); Beta-bagcell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP); Egg-laying hormone (ELH); Acidic peptide].
Source organism	Aplysia californica (California sea hare)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	Bag cell neurons
Post translational modification	N/A
Function	N/A
Protein Length	271 Amino acids
Molecular weight	30827
References	1  PubMed abstract 6687446 2  PubMed abstract 16593372 3  PubMed abstract 293751 4  PubMed abstract 3549995
Domain Name	ELH
Hormone Name	Epsilon-bag cell peptide
Mature Hormone Sequence	SVLTPSLSSLGESLESGIS
Position of mature hormone in Pre-Hormone protein	19 Residues from position (185-203)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	10609
Swiss-prot Accession number	P01362 (Sequence in FASTA format)
Description	ELH precursor [Contains: Alpha-bag cell peptide (Alpha-BCP); Beta-bagcell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP); Egg-laying hormone (ELH); Acidic peptide].
Source organism	Aplysia californica (California sea hare)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	Bag cell neurons
Post translational modification	N/A
Function	ELH acts as a neurotransmitter locally, upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis and expulsion of the egg string
Protein Length	271 Amino acids
Molecular weight	30827
References	1  PubMed abstract 6687446 2  PubMed abstract 16593372 3  PubMed abstract 293751 4  PubMed abstract 3549995
Domain Name	ELH
Hormone Name	Egg-laying hormone
Mature Hormone Sequence	ISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEK
Position of mature hormone in Pre-Hormone protein	36 Residues from position (206-241)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	10610
Swiss-prot Accession number	P17685 (Sequence in FASTA format)
Description	ELH type 1 precursor [Contains: Alpha-bag cell peptide (Alpha-BCP);Beta-bag cell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP);Egg-laying hormone (ELH); Acidic peptide].
Source organism	Aplysia parvula (Little sea hare)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	Bag cell neurons
Post translational modification	N/A
Function	Beta-BCP specifically excites 2 neurons, L1 and R1, in the abdominal ganglion
Protein Length	263 Amino acids
Molecular weight	29676
References	1  PubMed abstract 3734873
Domain Name	ELH
Hormone Name	Beta-bag cell peptide
Mature Hormone Sequence	RLRFH
Position of mature hormone in Pre-Hormone protein	5 Residues from position (88-92)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	10611
Swiss-prot Accession number	P17685 (Sequence in FASTA format)
Description	ELH type 1 precursor [Contains: Alpha-bag cell peptide (Alpha-BCP);Beta-bag cell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP);Egg-laying hormone (ELH); Acidic peptide].
Source organism	Aplysia parvula (Little sea hare)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	Bag cell neurons
Post translational modification	N/A
Function	Alpha-BCP decreases the activity of a cluster of neurons in the left upper quadrant of the abdominal ganglion
Protein Length	263 Amino acids
Molecular weight	29676
References	1  PubMed abstract 3734873
Domain Name	ELH
Hormone Name	Alpha-bag cell peptide
Mature Hormone Sequence	APRLRFYSL
Position of mature hormone in Pre-Hormone protein	9 Residues from position (142-150)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	10612
Swiss-prot Accession number	P17685 (Sequence in FASTA format)
Description	ELH type 1 precursor [Contains: Alpha-bag cell peptide (Alpha-BCP);Beta-bag cell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP);Egg-laying hormone (ELH); Acidic peptide].
Source organism	Aplysia parvula (Little sea hare)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	Bag cell neurons
Post translational modification	N/A
Function	ELH acts as a neurotransmitter locally, upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis and expulsion of the egg string
Protein Length	263 Amino acids
Molecular weight	29676
References	1  PubMed abstract 3734873
Domain Name	ELH
Hormone Name	Egg-laying hormone
Mature Hormone Sequence	ISINQDLKAIADMLIVEQKQEREKYLADLRQRLLNK
Position of mature hormone in Pre-Hormone protein	36 Residues from position (198-233)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	10654
Swiss-prot Accession number	P06308 (Sequence in FASTA format)
Description	Ovulation prohormone precursor [Contains: Beta-3-CDCP; Beta-2-CDCP;Beta-1-CDCP; Calfluxin; Alpha-CDCP; Ovulation hormone (Cerebralneurosecretory caudodorsal cell hormone) (CDCH); X-CDCP].
Source organism	Lymnaea stagnalis (Great pond snail)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Pulmonata; Basommatophora;Lymnaeoidea; Lymnaeidae; Lymnaea.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	259 Amino acids
Molecular weight	29613
References	1  PubMed abstract 3183719 2  PubMed abstract 16578788
Domain Name	ELH
Hormone Name	Beta-3-CDCP
Mature Hormone Sequence	RLRFN
Position of mature hormone in Pre-Hormone protein	5 Residues from position (105-109)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 14

HMRbase accession number	10655
Swiss-prot Accession number	P06308 (Sequence in FASTA format)
Description	Ovulation prohormone precursor [Contains: Beta-3-CDCP; Beta-2-CDCP;Beta-1-CDCP; Calfluxin; Alpha-CDCP; Ovulation hormone (Cerebralneurosecretory caudodorsal cell hormone) (CDCH); X-CDCP].
Source organism	Lymnaea stagnalis (Great pond snail)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Pulmonata; Basommatophora;Lymnaeoidea; Lymnaeidae; Lymnaea.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	259 Amino acids
Molecular weight	29613
References	1  PubMed abstract 3183719 2  PubMed abstract 16578788
Domain Name	ELH
Hormone Name	Beta-1-CDCP
Mature Hormone Sequence	RLRFH
Position of mature hormone in Pre-Hormone protein	5 Residues from position (119-123)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 15

HMRbase accession number	10656
Swiss-prot Accession number	P06308 (Sequence in FASTA format)
Description	Ovulation prohormone precursor [Contains: Beta-3-CDCP; Beta-2-CDCP;Beta-1-CDCP; Calfluxin; Alpha-CDCP; Ovulation hormone (Cerebralneurosecretory caudodorsal cell hormone) (CDCH); X-CDCP].
Source organism	Lymnaea stagnalis (Great pond snail)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Pulmonata; Basommatophora;Lymnaeoidea; Lymnaeidae; Lymnaea.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Calfluxin is involved in the influx of calcium into mitochondria of the albumen gland
Protein Length	259 Amino acids
Molecular weight	29613
References	1  PubMed abstract 3183719 2  PubMed abstract 16578788
Domain Name	ELH
Hormone Name	Calfluxin
Mature Hormone Sequence	RVDSADESNDDGFD
Position of mature hormone in Pre-Hormone protein	14 Residues from position (126-139)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 16

HMRbase accession number	10657
Swiss-prot Accession number	P06308 (Sequence in FASTA format)
Description	Ovulation prohormone precursor [Contains: Beta-3-CDCP; Beta-2-CDCP;Beta-1-CDCP; Calfluxin; Alpha-CDCP; Ovulation hormone (Cerebralneurosecretory caudodorsal cell hormone) (CDCH); X-CDCP].
Source organism	Lymnaea stagnalis (Great pond snail)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Pulmonata; Basommatophora;Lymnaeoidea; Lymnaeidae; Lymnaea.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	CDCA (or alpha-CDCP) triggers the electrical activity of the caudodorsal cells (CDCS).
Protein Length	259 Amino acids
Molecular weight	29613
References	1  PubMed abstract 3183719 2  PubMed abstract 16578788
Domain Name	ELH
Hormone Name	Alpha-CDCP
Mature Hormone Sequence	EPRLRFHDV
Position of mature hormone in Pre-Hormone protein	9 Residues from position (144-152)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 17

HMRbase accession number	10658
Swiss-prot Accession number	P06308 (Sequence in FASTA format)
Description	Ovulation prohormone precursor [Contains: Beta-3-CDCP; Beta-2-CDCP;Beta-1-CDCP; Calfluxin; Alpha-CDCP; Ovulation hormone (Cerebralneurosecretory caudodorsal cell hormone) (CDCH); X-CDCP].
Source organism	Lymnaea stagnalis (Great pond snail)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Pulmonata; Basommatophora;Lymnaeoidea; Lymnaeidae; Lymnaea.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	259 Amino acids
Molecular weight	29613
References	1  PubMed abstract 3183719 2  PubMed abstract 16578788
Domain Name	ELH
Hormone Name	X-CDCP
Mature Hormone Sequence	SATAEEGSENAEIEESHLGNSRS
Position of mature hormone in Pre-Hormone protein	23 Residues from position (156-178)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 18

HMRbase accession number	10659
Swiss-prot Accession number	P06308 (Sequence in FASTA format)
Description	Ovulation prohormone precursor [Contains: Beta-3-CDCP; Beta-2-CDCP;Beta-1-CDCP; Calfluxin; Alpha-CDCP; Ovulation hormone (Cerebralneurosecretory caudodorsal cell hormone) (CDCH); X-CDCP].
Source organism	Lymnaea stagnalis (Great pond snail)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Pulmonata; Basommatophora;Lymnaeoidea; Lymnaeidae; Lymnaea.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	CDCH induces ovulation and egg-mass production; it may also stimulate synthesis of secretory products in the female accessory sex glands and affect neurons in the neuronal circuits controlling locomotion and feeding
Protein Length	259 Amino acids
Molecular weight	29613
References	1  PubMed abstract 3183719 2  PubMed abstract 16578788
Domain Name	ELH
Hormone Name	Ovulation hormone
Mature Hormone Sequence	LSITNDLRAIADSYLYDQHKLRERQEENLRRRFLEL
Position of mature hormone in Pre-Hormone protein	36 Residues from position (198-233)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated