A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10582 |
Swiss-prot Accession number | P14944 (Sequence in FASTA format) |
Description | Crustacean hyperglycemic hormones precursor [Contains: CHH precursor-related peptide (CPRP); Crustacean hyperglycemic hormone (CHH)]. |
Source organism | Carcinus maenas (Common shore crab) (Green crab) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Brachyura;Eubrachyura; Portunoidea; Portunidae; Carcinus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released |
Post translational modification | The N-terminus is blocked only in isoform CHH-II but not in isoform CHH-I. |
Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
Protein Length | 142 Amino acids |
Molecular weight | 16138 |
References | 1 PubMed abstract 2806562 2 PubMed abstract 2792364 3 PubMed abstract 1788131 4 PubMed abstract 8841399 |
Domain Name | Crust_neurohorm Crust_neuro_H |
Hormone Name | Crustacean hyperglycemic hormone |
Mature Hormone Sequence | QIYDTSCKGVYDRALFNDLEHVCDDCYNLYRTSYVASACRSNCYSNLVFRQCMDDLLMMDEFDQYARKVQMV |
Position of mature hormone in Pre-Hormone protein | 72 Residues from position (67-138) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10653 |
Swiss-prot Accession number | P56688 (Sequence in FASTA format) |
Description | Mandibular organ-inhibiting hormone precursor (MOIH) [Contains: MOIHprecursor-related peptide; Mandibular organ-inhibiting hormone]. |
Source organism | Libinia emarginata (Spider crab) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Brachyura;Eubrachyura; Majoidea; Majidae; Libinia. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where it is stored and released |
Post translational modification | N/A |
Function | Represses the synthesis of methyl farnesoate, the precursor of insect juvenile hormone III in the mandibular organ. Also has hyperglycemic activity |
Protein Length | 137 Amino acids |
Molecular weight | 15370 |
References | 1 PubMed abstract 9783445 2 PubMed abstract 9299429 |
Domain Name | Crust_neurohorm Crust_neuro_H |
Hormone Name | Mandibular organ-inhibiting hormone |
Mature Hormone Sequence | QIFDPSCKGLYDRGLFSDLEHVCKDCYNLYRNPQVTSACRVNCYSNRVFRQCMEDLLLMEDFDKYARAIQTV |
Position of mature hormone in Pre-Hormone protein | 72 Residues from position (63-134) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |