A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10006
Swiss-prot Accession number	Q04618 (Sequence in FASTA format)
Description	Corticotropin-lipotropin B precursor (Pro-opiomelanocortin B) (POMC B)[Contains: NPP 2; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 2 (Alpha-MSH 2); Corticotropin-like intermediarypeptide 2 (CLIP-2); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 2 (Beta-MSH 2); Beta-endorphin 2; Met-enkephalin].
Source organism	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	N/A
Developmental Stage	Expressed only in sexually active fish.
Similarity	Belongs to the POMC family.
Tissue Specificity	Pituitary and hypothalamus of adult diploid animals
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner.
Function	N/A
Protein Length	240 Amino acids
Molecular weight	26719
References	1  PubMed abstract 1448114 2  PubMed abstract 1448114
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin alpha 2
Mature Hormone Sequence	SYSMEHFRWGKPI
Position of mature hormone in Pre-Hormone protein	13 Residues from position (112-124)
Receptor	Q6QLQ0   Detail in HMRbase    Q6QLQ1    Detail in HMRbase
Gene ID	100136772
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 2

HMRbase accession number	10315
Swiss-prot Accession number	Q04618 (Sequence in FASTA format)
Description	Corticotropin-lipotropin B precursor (Pro-opiomelanocortin B) (POMC B)[Contains: NPP 2; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 2 (Alpha-MSH 2); Corticotropin-like intermediarypeptide 2 (CLIP-2); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 2 (Beta-MSH 2); Beta-endorphin 2; Met-enkephalin].
Source organism	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	N/A
Developmental Stage	Expressed only in sexually active fish.
Similarity	Belongs to the POMC family.
Tissue Specificity	Pituitary and hypothalamus of adult diploid animals
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner.
Function	N/A
Protein Length	240 Amino acids
Molecular weight	26719
References	1  PubMed abstract 1448114 2  PubMed abstract 1448114
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPIGHKRRPIKVYASSLEGGDSSEGTFPLQA
Position of mature hormone in Pre-Hormone protein	41 Residues from position (112-152)
Receptor	Q6QLQ0   Detail in HMRbase    Q6QLQ1    Detail in HMRbase
Gene ID	100136772
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 3

HMRbase accession number	10316
Swiss-prot Accession number	Q04618 (Sequence in FASTA format)
Description	Corticotropin-lipotropin B precursor (Pro-opiomelanocortin B) (POMC B)[Contains: NPP 2; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 2 (Alpha-MSH 2); Corticotropin-like intermediarypeptide 2 (CLIP-2); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 2 (Beta-MSH 2); Beta-endorphin 2; Met-enkephalin].
Source organism	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	N/A
Developmental Stage	Expressed only in sexually active fish.
Similarity	Belongs to the POMC family.
Tissue Specificity	Pituitary and hypothalamus of adult diploid animals
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner.
Function	N/A
Protein Length	240 Amino acids
Molecular weight	26719
References	1  PubMed abstract 1448114 2  PubMed abstract 1448114
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	QLSSWEDEMVGALGNQGAKAQTKVVPRTLTVTGLQDKKDGSYRMGHFRWGSPTAIKRYGGFMKPYTQQSHKPLITLLKHVTLKNEQ
Position of mature hormone in Pre-Hormone protein	86 Residues from position (155-240)
Receptor	Q6QLQ0   Detail in HMRbase    Q6QLQ1    Detail in HMRbase
Gene ID	100136772
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 4

HMRbase accession number	10317
Swiss-prot Accession number	Q04618 (Sequence in FASTA format)
Description	Corticotropin-lipotropin B precursor (Pro-opiomelanocortin B) (POMC B)[Contains: NPP 2; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 2 (Alpha-MSH 2); Corticotropin-like intermediarypeptide 2 (CLIP-2); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 2 (Beta-MSH 2); Beta-endorphin 2; Met-enkephalin].
Source organism	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	N/A
Developmental Stage	Expressed only in sexually active fish.
Similarity	Belongs to the POMC family.
Tissue Specificity	Pituitary and hypothalamus of adult diploid animals
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner.
Function	N/A
Protein Length	240 Amino acids
Molecular weight	26719
References	1  PubMed abstract 1448114 2  PubMed abstract 1448114
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	QLSSWEDEMVGALGNQGAKAQTKVVPRTLTVTGLQDKKDGSYRMGHFRWGSPTAI
Position of mature hormone in Pre-Hormone protein	55 Residues from position (155-209)
Receptor	Q6QLQ0   Detail in HMRbase    Q6QLQ1    Detail in HMRbase
Gene ID	100136772
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 5

HMRbase accession number	10318
Swiss-prot Accession number	Q04618 (Sequence in FASTA format)
Description	Corticotropin-lipotropin B precursor (Pro-opiomelanocortin B) (POMC B)[Contains: NPP 2; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 2 (Alpha-MSH 2); Corticotropin-like intermediarypeptide 2 (CLIP-2); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 2 (Beta-MSH 2); Beta-endorphin 2; Met-enkephalin].
Source organism	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	N/A
Developmental Stage	Expressed only in sexually active fish.
Similarity	Belongs to the POMC family.
Tissue Specificity	Pituitary and hypothalamus of adult diploid animals
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner.
Function	N/A
Protein Length	240 Amino acids
Molecular weight	26719
References	1  PubMed abstract 1448114 2  PubMed abstract 1448114
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin beta 2
Mature Hormone Sequence	DGSYRMGHFRWGSPTAI
Position of mature hormone in Pre-Hormone protein	17 Residues from position (193-209)
Receptor	Q6QLQ0   Detail in HMRbase    Q6QLQ1    Detail in HMRbase
Gene ID	100136772
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 6

HMRbase accession number	10319
Swiss-prot Accession number	Q04618 (Sequence in FASTA format)
Description	Corticotropin-lipotropin B precursor (Pro-opiomelanocortin B) (POMC B)[Contains: NPP 2; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 2 (Alpha-MSH 2); Corticotropin-like intermediarypeptide 2 (CLIP-2); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 2 (Beta-MSH 2); Beta-endorphin 2; Met-enkephalin].
Source organism	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	N/A
Developmental Stage	Expressed only in sexually active fish.
Similarity	Belongs to the POMC family.
Tissue Specificity	Pituitary and hypothalamus of adult diploid animals
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner.
Function	N/A
Protein Length	240 Amino acids
Molecular weight	26719
References	1  PubMed abstract 1448114 2  PubMed abstract 1448114
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Beta-endorphin 2
Mature Hormone Sequence	YGGFMKPYTQQSHKPLITLLKHVTLKNEQ
Position of mature hormone in Pre-Hormone protein	29 Residues from position (212-240)
Receptor	Q6QLQ0   Detail in HMRbase    Q6QLQ1    Detail in HMRbase
Gene ID	100136772
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 7

HMRbase accession number	10926
Swiss-prot Accession number	P19402 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Cavia porcellus (Guinea pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	256 Amino acids
Molecular weight	28264
References	1  PubMed abstract 1662166 2  PubMed abstract 2830360 3  PubMed abstract 1662166 4  PubMed abstract 2830360
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	DDGSYRMEHFRWGTPRKG
Position of mature hormone in Pre-Hormone protein	18 Residues from position (206-223)
Receptor	Q9Z1S9    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 8

HMRbase accession number	10942
Swiss-prot Accession number	P10000 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Oncorhynchus keta (Chum salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	226 Amino acids
Molecular weight	24982
References	1  PubMed abstract 3197404 2  PubMed abstract 6095185 3  PubMed abstract 6087806 4  PubMed abstract 7447938 5  PubMed abstract 475783 6  PubMed abstract 3197404 7  PubMed abstract 6095185 8  PubMed abstract 6087806 9  PubMed abstract 7447938 10  PubMed abstract 475783
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPIGHKRRPIKVYASSLEGGDSSEGTFPLQA
Position of mature hormone in Pre-Hormone protein	41 Residues from position (98-138)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	10943
Swiss-prot Accession number	P10000 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Oncorhynchus keta (Chum salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	226 Amino acids
Molecular weight	24982
References	1  PubMed abstract 3197404 2  PubMed abstract 6095185 3  PubMed abstract 6087806 4  PubMed abstract 7447938 5  PubMed abstract 475783 6  PubMed abstract 3197404 7  PubMed abstract 6095185 8  PubMed abstract 6087806 9  PubMed abstract 7447938 10  PubMed abstract 475783
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPIGH
Position of mature hormone in Pre-Hormone protein	15 Residues from position (98-112)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	10944
Swiss-prot Accession number	P10000 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Oncorhynchus keta (Chum salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	226 Amino acids
Molecular weight	24982
References	1  PubMed abstract 3197404 2  PubMed abstract 6095185 3  PubMed abstract 6087806 4  PubMed abstract 7447938 5  PubMed abstract 475783 6  PubMed abstract 3197404 7  PubMed abstract 6095185 8  PubMed abstract 6087806 9  PubMed abstract 7447938 10  PubMed abstract 475783
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	QLGSWEDEMVGALGNQGAKAQTKVVPRTLTVTGLQDKKDGSYRMGHFRWGSPTAIKRYGGFMKPYTKQSHKPLITLLKHITLKNEQ
Position of mature hormone in Pre-Hormone protein	86 Residues from position (141-226)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	10945
Swiss-prot Accession number	P10000 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Oncorhynchus keta (Chum salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	226 Amino acids
Molecular weight	24982
References	1  PubMed abstract 3197404 2  PubMed abstract 6095185 3  PubMed abstract 6087806 4  PubMed abstract 7447938 5  PubMed abstract 475783 6  PubMed abstract 3197404 7  PubMed abstract 6095185 8  PubMed abstract 6087806 9  PubMed abstract 7447938 10  PubMed abstract 475783
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	QLGSWEDEMVGALGNQGAKAQTKVVPRTLTVTGLQDKKDGSYRMGHFRWGSPTAI
Position of mature hormone in Pre-Hormone protein	55 Residues from position (141-195)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	10946
Swiss-prot Accession number	P10000 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Oncorhynchus keta (Chum salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	226 Amino acids
Molecular weight	24982
References	1  PubMed abstract 3197404 2  PubMed abstract 6095185 3  PubMed abstract 6087806 4  PubMed abstract 7447938 5  PubMed abstract 475783 6  PubMed abstract 3197404 7  PubMed abstract 6095185 8  PubMed abstract 6087806 9  PubMed abstract 7447938 10  PubMed abstract 475783
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	DGSYRMGHFRWGSPTAI
Position of mature hormone in Pre-Hormone protein	17 Residues from position (179-195)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	10947
Swiss-prot Accession number	P10000 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Oncorhynchus keta (Chum salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	226 Amino acids
Molecular weight	24982
References	1  PubMed abstract 3197404 2  PubMed abstract 6095185 3  PubMed abstract 6087806 4  PubMed abstract 7447938 5  PubMed abstract 475783 6  PubMed abstract 3197404 7  PubMed abstract 6095185 8  PubMed abstract 6087806 9  PubMed abstract 7447938 10  PubMed abstract 475783
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMKPYTKQSHKPLITLLKHITLKNEQ
Position of mature hormone in Pre-Hormone protein	29 Residues from position (198-226)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 14

HMRbase accession number	10948
Swiss-prot Accession number	P10000 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Oncorhynchus keta (Chum salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	226 Amino acids
Molecular weight	24982
References	1  PubMed abstract 3197404 2  PubMed abstract 6095185 3  PubMed abstract 6087806 4  PubMed abstract 7447938 5  PubMed abstract 475783 6  PubMed abstract 3197404 7  PubMed abstract 6095185 8  PubMed abstract 6087806 9  PubMed abstract 7447938 10  PubMed abstract 475783
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (198-202)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 15

HMRbase accession number	11250
Swiss-prot Accession number	P01189 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides. O-glycosylated; reducing sugar is probably N- acetylgalactosamine.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	267 Amino acids
Molecular weight	29424
References	1  PubMed abstract 6274691 2  PubMed abstract 6299668 3  PubMed abstract 6314261 4  PubMed abstract 15489334 5  PubMed abstract 3606677 6  PubMed abstract 6254047 7  PubMed abstract 6945581 8  PubMed abstract 6267033 9  PubMed abstract 6272808 10  PubMed abstract 4352834 11  PubMed abstract 14463577 12  PubMed abstract 15340161 13  PubMed abstract 4334191 14  PubMed abstract 4338630 15  PubMed abstract 4347148 16  PubMed abstract 1264228 17   Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 18  PubMed abstract 195688 19  PubMed abstract 2424570 20  PubMed abstract 2839146 21  PubMed abstract 7828531 22  PubMed abstract 9620771 23  PubMed abstract 16046320 24  PubMed abstract 16807684 25  PubMed abstract 9768693 26  PubMed abstract 10193875 27  PubMed abstract 11244459 28  PubMed abstract 12165561 29  PubMed abstract 6274691 30  PubMed abstract 6299668 31  PubMed abstract 6314261 32  PubMed abstract 15489334 33  PubMed abstract 3606677 34  PubMed abstract 6254047 35  PubMed abstract 6945581 36  PubMed abstract 6267033 37  PubMed abstract 6272808 38  PubMed abstract 4352834 39  PubMed abstract 14463577 40  PubMed abstract 15340161 41  PubMed abstract 4334191 42  PubMed abstract 4338630 43  PubMed abstract 4347148 44  PubMed abstract 1264228 45   Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 46  PubMed abstract 195688 47  PubMed abstract 2424570 48  PubMed abstract 2839146 49  PubMed abstract 7828531 50  PubMed abstract 9620771 51  PubMed abstract 16046320 52  PubMed abstract 16807684 53  PubMed abstract 9768693 54  PubMed abstract 10193875 55  PubMed abstract 11244459 56  PubMed abstract 12165561
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin gamma (Gamma-MSH)
Mature Hormone Sequence	YVMGHFRWDRF
Position of mature hormone in Pre-Hormone protein	11 Residues from position (77-87)
Receptor	Q01726    Detail in HMRbase
Gene ID	5443
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 16

HMRbase accession number	11251
Swiss-prot Accession number	P01189 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides. O-glycosylated; reducing sugar is probably N- acetylgalactosamine.
Function	ACTH stimulates the adrenal glands to release cortisol
Protein Length	267 Amino acids
Molecular weight	29424
References	1  PubMed abstract 6274691 2  PubMed abstract 6299668 3  PubMed abstract 6314261 4  PubMed abstract 15489334 5  PubMed abstract 3606677 6  PubMed abstract 6254047 7  PubMed abstract 6945581 8  PubMed abstract 6267033 9  PubMed abstract 6272808 10  PubMed abstract 4352834 11  PubMed abstract 14463577 12  PubMed abstract 15340161 13  PubMed abstract 4334191 14  PubMed abstract 4338630 15  PubMed abstract 4347148 16  PubMed abstract 1264228 17   Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 18  PubMed abstract 195688 19  PubMed abstract 2424570 20  PubMed abstract 2839146 21  PubMed abstract 7828531 22  PubMed abstract 9620771 23  PubMed abstract 16046320 24  PubMed abstract 16807684 25  PubMed abstract 9768693 26  PubMed abstract 10193875 27  PubMed abstract 11244459 28  PubMed abstract 12165561 29  PubMed abstract 6274691 30  PubMed abstract 6299668 31  PubMed abstract 6314261 32  PubMed abstract 15489334 33  PubMed abstract 3606677 34  PubMed abstract 6254047 35  PubMed abstract 6945581 36  PubMed abstract 6267033 37  PubMed abstract 6272808 38  PubMed abstract 4352834 39  PubMed abstract 14463577 40  PubMed abstract 15340161 41  PubMed abstract 4334191 42  PubMed abstract 4338630 43  PubMed abstract 4347148 44  PubMed abstract 1264228 45   Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 46  PubMed abstract 195688 47  PubMed abstract 2424570 48  PubMed abstract 2839146 49  PubMed abstract 7828531 50  PubMed abstract 9620771 51  PubMed abstract 16046320 52  PubMed abstract 16807684 53  PubMed abstract 9768693 54  PubMed abstract 10193875 55  PubMed abstract 11244459 56  PubMed abstract 12165561
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (138-176)
Receptor	Q01726    Detail in HMRbase
Gene ID	5443
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 17

HMRbase accession number	11252
Swiss-prot Accession number	P01189 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides. O-glycosylated; reducing sugar is probably N- acetylgalactosamine.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	267 Amino acids
Molecular weight	29424
References	1  PubMed abstract 6274691 2  PubMed abstract 6299668 3  PubMed abstract 6314261 4  PubMed abstract 15489334 5  PubMed abstract 3606677 6  PubMed abstract 6254047 7  PubMed abstract 6945581 8  PubMed abstract 6267033 9  PubMed abstract 6272808 10  PubMed abstract 4352834 11  PubMed abstract 14463577 12  PubMed abstract 15340161 13  PubMed abstract 4334191 14  PubMed abstract 4338630 15  PubMed abstract 4347148 16  PubMed abstract 1264228 17   Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 18  PubMed abstract 195688 19  PubMed abstract 2424570 20  PubMed abstract 2839146 21  PubMed abstract 7828531 22  PubMed abstract 9620771 23  PubMed abstract 16046320 24  PubMed abstract 16807684 25  PubMed abstract 9768693 26  PubMed abstract 10193875 27  PubMed abstract 11244459 28  PubMed abstract 12165561 29  PubMed abstract 6274691 30  PubMed abstract 6299668 31  PubMed abstract 6314261 32  PubMed abstract 15489334 33  PubMed abstract 3606677 34  PubMed abstract 6254047 35  PubMed abstract 6945581 36  PubMed abstract 6267033 37  PubMed abstract 6272808 38  PubMed abstract 4352834 39  PubMed abstract 14463577 40  PubMed abstract 15340161 41  PubMed abstract 4334191 42  PubMed abstract 4338630 43  PubMed abstract 4347148 44  PubMed abstract 1264228 45   Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 46  PubMed abstract 195688 47  PubMed abstract 2424570 48  PubMed abstract 2839146 49  PubMed abstract 7828531 50  PubMed abstract 9620771 51  PubMed abstract 16046320 52  PubMed abstract 16807684 53  PubMed abstract 9768693 54  PubMed abstract 10193875 55  PubMed abstract 11244459 56  PubMed abstract 12165561
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (138-150)
Receptor	Q01726    Detail in HMRbase
Gene ID	5443
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 18

HMRbase accession number	11253
Swiss-prot Accession number	P01189 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides. O-glycosylated; reducing sugar is probably N- acetylgalactosamine.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	267 Amino acids
Molecular weight	29424
References	1  PubMed abstract 6274691 2  PubMed abstract 6299668 3  PubMed abstract 6314261 4  PubMed abstract 15489334 5  PubMed abstract 3606677 6  PubMed abstract 6254047 7  PubMed abstract 6945581 8  PubMed abstract 6267033 9  PubMed abstract 6272808 10  PubMed abstract 4352834 11  PubMed abstract 14463577 12  PubMed abstract 15340161 13  PubMed abstract 4334191 14  PubMed abstract 4338630 15  PubMed abstract 4347148 16  PubMed abstract 1264228 17   Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 18  PubMed abstract 195688 19  PubMed abstract 2424570 20  PubMed abstract 2839146 21  PubMed abstract 7828531 22  PubMed abstract 9620771 23  PubMed abstract 16046320 24  PubMed abstract 16807684 25  PubMed abstract 9768693 26  PubMed abstract 10193875 27  PubMed abstract 11244459 28  PubMed abstract 12165561 29  PubMed abstract 6274691 30  PubMed abstract 6299668 31  PubMed abstract 6314261 32  PubMed abstract 15489334 33  PubMed abstract 3606677 34  PubMed abstract 6254047 35  PubMed abstract 6945581 36  PubMed abstract 6267033 37  PubMed abstract 6272808 38  PubMed abstract 4352834 39  PubMed abstract 14463577 40  PubMed abstract 15340161 41  PubMed abstract 4334191 42  PubMed abstract 4338630 43  PubMed abstract 4347148 44  PubMed abstract 1264228 45   Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 46  PubMed abstract 195688 47  PubMed abstract 2424570 48  PubMed abstract 2839146 49  PubMed abstract 7828531 50  PubMed abstract 9620771 51  PubMed abstract 16046320 52  PubMed abstract 16807684 53  PubMed abstract 9768693 54  PubMed abstract 10193875 55  PubMed abstract 11244459 56  PubMed abstract 12165561
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELTGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Position of mature hormone in Pre-Hormone protein	89 Residues from position (179-267)
Receptor	Q01726    Detail in HMRbase
Gene ID	5443
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 19

HMRbase accession number	11254
Swiss-prot Accession number	P01189 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides. O-glycosylated; reducing sugar is probably N- acetylgalactosamine.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	267 Amino acids
Molecular weight	29424
References	1  PubMed abstract 6274691 2  PubMed abstract 6299668 3  PubMed abstract 6314261 4  PubMed abstract 15489334 5  PubMed abstract 3606677 6  PubMed abstract 6254047 7  PubMed abstract 6945581 8  PubMed abstract 6267033 9  PubMed abstract 6272808 10  PubMed abstract 4352834 11  PubMed abstract 14463577 12  PubMed abstract 15340161 13  PubMed abstract 4334191 14  PubMed abstract 4338630 15  PubMed abstract 4347148 16  PubMed abstract 1264228 17   Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 18  PubMed abstract 195688 19  PubMed abstract 2424570 20  PubMed abstract 2839146 21  PubMed abstract 7828531 22  PubMed abstract 9620771 23  PubMed abstract 16046320 24  PubMed abstract 16807684 25  PubMed abstract 9768693 26  PubMed abstract 10193875 27  PubMed abstract 11244459 28  PubMed abstract 12165561 29  PubMed abstract 6274691 30  PubMed abstract 6299668 31  PubMed abstract 6314261 32  PubMed abstract 15489334 33  PubMed abstract 3606677 34  PubMed abstract 6254047 35  PubMed abstract 6945581 36  PubMed abstract 6267033 37  PubMed abstract 6272808 38  PubMed abstract 4352834 39  PubMed abstract 14463577 40  PubMed abstract 15340161 41  PubMed abstract 4334191 42  PubMed abstract 4338630 43  PubMed abstract 4347148 44  PubMed abstract 1264228 45   Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 46  PubMed abstract 195688 47  PubMed abstract 2424570 48  PubMed abstract 2839146 49  PubMed abstract 7828531 50  PubMed abstract 9620771 51  PubMed abstract 16046320 52  PubMed abstract 16807684 53  PubMed abstract 9768693 54  PubMed abstract 10193875 55  PubMed abstract 11244459 56  PubMed abstract 12165561
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELTGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	56 Residues from position (179-234)
Receptor	Q01726    Detail in HMRbase
Gene ID	5443
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 20

HMRbase accession number	11255
Swiss-prot Accession number	P01189 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides. O-glycosylated; reducing sugar is probably N- acetylgalactosamine.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	267 Amino acids
Molecular weight	29424
References	1  PubMed abstract 6274691 2  PubMed abstract 6299668 3  PubMed abstract 6314261 4  PubMed abstract 15489334 5  PubMed abstract 3606677 6  PubMed abstract 6254047 7  PubMed abstract 6945581 8  PubMed abstract 6267033 9  PubMed abstract 6272808 10  PubMed abstract 4352834 11  PubMed abstract 14463577 12  PubMed abstract 15340161 13  PubMed abstract 4334191 14  PubMed abstract 4338630 15  PubMed abstract 4347148 16  PubMed abstract 1264228 17   Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 18  PubMed abstract 195688 19  PubMed abstract 2424570 20  PubMed abstract 2839146 21  PubMed abstract 7828531 22  PubMed abstract 9620771 23  PubMed abstract 16046320 24  PubMed abstract 16807684 25  PubMed abstract 9768693 26  PubMed abstract 10193875 27  PubMed abstract 11244459 28  PubMed abstract 12165561 29  PubMed abstract 6274691 30  PubMed abstract 6299668 31  PubMed abstract 6314261 32  PubMed abstract 15489334 33  PubMed abstract 3606677 34  PubMed abstract 6254047 35  PubMed abstract 6945581 36  PubMed abstract 6267033 37  PubMed abstract 6272808 38  PubMed abstract 4352834 39  PubMed abstract 14463577 40  PubMed abstract 15340161 41  PubMed abstract 4334191 42  PubMed abstract 4338630 43  PubMed abstract 4347148 44  PubMed abstract 1264228 45   Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 46  PubMed abstract 195688 47  PubMed abstract 2424570 48  PubMed abstract 2839146 49  PubMed abstract 7828531 50  PubMed abstract 9620771 51  PubMed abstract 16046320 52  PubMed abstract 16807684 53  PubMed abstract 9768693 54  PubMed abstract 10193875 55  PubMed abstract 11244459 56  PubMed abstract 12165561
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	DEGPYRMEHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	18 Residues from position (217-234)
Receptor	Q01726    Detail in HMRbase
Gene ID	5443
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 21

HMRbase accession number	11256
Swiss-prot Accession number	P01189 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides. O-glycosylated; reducing sugar is probably N- acetylgalactosamine.
Function	Beta-endorphin is an endogenous opiate
Protein Length	267 Amino acids
Molecular weight	29424
References	1  PubMed abstract 6274691 2  PubMed abstract 6299668 3  PubMed abstract 6314261 4  PubMed abstract 15489334 5  PubMed abstract 3606677 6  PubMed abstract 6254047 7  PubMed abstract 6945581 8  PubMed abstract 6267033 9  PubMed abstract 6272808 10  PubMed abstract 4352834 11  PubMed abstract 14463577 12  PubMed abstract 15340161 13  PubMed abstract 4334191 14  PubMed abstract 4338630 15  PubMed abstract 4347148 16  PubMed abstract 1264228 17   Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 18  PubMed abstract 195688 19  PubMed abstract 2424570 20  PubMed abstract 2839146 21  PubMed abstract 7828531 22  PubMed abstract 9620771 23  PubMed abstract 16046320 24  PubMed abstract 16807684 25  PubMed abstract 9768693 26  PubMed abstract 10193875 27  PubMed abstract 11244459 28  PubMed abstract 12165561 29  PubMed abstract 6274691 30  PubMed abstract 6299668 31  PubMed abstract 6314261 32  PubMed abstract 15489334 33  PubMed abstract 3606677 34  PubMed abstract 6254047 35  PubMed abstract 6945581 36  PubMed abstract 6267033 37  PubMed abstract 6272808 38  PubMed abstract 4352834 39  PubMed abstract 14463577 40  PubMed abstract 15340161 41  PubMed abstract 4334191 42  PubMed abstract 4338630 43  PubMed abstract 4347148 44  PubMed abstract 1264228 45   Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 46  PubMed abstract 195688 47  PubMed abstract 2424570 48  PubMed abstract 2839146 49  PubMed abstract 7828531 50  PubMed abstract 9620771 51  PubMed abstract 16046320 52  PubMed abstract 16807684 53  PubMed abstract 9768693 54  PubMed abstract 10193875 55  PubMed abstract 11244459 56  PubMed abstract 12165561
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Position of mature hormone in Pre-Hormone protein	31 Residues from position (237-267)
Receptor	Q01726    Detail in HMRbase
Gene ID	5443
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 22

HMRbase accession number	11257
Swiss-prot Accession number	P01189 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides. O-glycosylated; reducing sugar is probably N- acetylgalactosamine.
Function	Met-enkephalin is an endogenous opiate
Protein Length	267 Amino acids
Molecular weight	29424
References	1  PubMed abstract 6274691 2  PubMed abstract 6299668 3  PubMed abstract 6314261 4  PubMed abstract 15489334 5  PubMed abstract 3606677 6  PubMed abstract 6254047 7  PubMed abstract 6945581 8  PubMed abstract 6267033 9  PubMed abstract 6272808 10  PubMed abstract 4352834 11  PubMed abstract 14463577 12  PubMed abstract 15340161 13  PubMed abstract 4334191 14  PubMed abstract 4338630 15  PubMed abstract 4347148 16  PubMed abstract 1264228 17   Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 18  PubMed abstract 195688 19  PubMed abstract 2424570 20  PubMed abstract 2839146 21  PubMed abstract 7828531 22  PubMed abstract 9620771 23  PubMed abstract 16046320 24  PubMed abstract 16807684 25  PubMed abstract 9768693 26  PubMed abstract 10193875 27  PubMed abstract 11244459 28  PubMed abstract 12165561 29  PubMed abstract 6274691 30  PubMed abstract 6299668 31  PubMed abstract 6314261 32  PubMed abstract 15489334 33  PubMed abstract 3606677 34  PubMed abstract 6254047 35  PubMed abstract 6945581 36  PubMed abstract 6267033 37  PubMed abstract 6272808 38  PubMed abstract 4352834 39  PubMed abstract 14463577 40  PubMed abstract 15340161 41  PubMed abstract 4334191 42  PubMed abstract 4338630 43  PubMed abstract 4347148 44  PubMed abstract 1264228 45   Harris J.I.; "Structure of a melanocyte-stimulating hormone from the humanpituitary gland."; Nature 184:167-169(1959). 46  PubMed abstract 195688 47  PubMed abstract 2424570 48  PubMed abstract 2839146 49  PubMed abstract 7828531 50  PubMed abstract 9620771 51  PubMed abstract 16046320 52  PubMed abstract 16807684 53  PubMed abstract 9768693 54  PubMed abstract 10193875 55  PubMed abstract 11244459 56  PubMed abstract 12165561
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (237-241)
Receptor	Q01726    Detail in HMRbase
Gene ID	5443
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 23

HMRbase accession number	11258
Swiss-prot Accession number	P01190 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Beta-endorphin is an endogenous opiate
Protein Length	265 Amino acids
Molecular weight	29260
References	1  PubMed abstract 221818 2  PubMed abstract 6249166 3  PubMed abstract 6263630 4   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6  PubMed abstract 216007 7  PubMed abstract 7274457 8  PubMed abstract 13642798 9   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10  PubMed abstract 4344689 11   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13  PubMed abstract 13348631 14  PubMed abstract 1065904 15  PubMed abstract 4030947 16  PubMed abstract 2266117 17  PubMed abstract 221818 18  PubMed abstract 6249166 19  PubMed abstract 6263630 20   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22  PubMed abstract 216007 23  PubMed abstract 7274457 24  PubMed abstract 13642798 25   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26  PubMed abstract 4344689 27   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29  PubMed abstract 13348631 30  PubMed abstract 1065904 31  PubMed abstract 4030947 32  PubMed abstract 2266117
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	31 Residues from position (235-265)
Receptor	P47798    Detail in HMRbase
Gene ID	281416
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 24

HMRbase accession number	11259
Swiss-prot Accession number	P01190 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	265 Amino acids
Molecular weight	29260
References	1  PubMed abstract 221818 2  PubMed abstract 6249166 3  PubMed abstract 6263630 4   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6  PubMed abstract 216007 7  PubMed abstract 7274457 8  PubMed abstract 13642798 9   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10  PubMed abstract 4344689 11   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13  PubMed abstract 13348631 14  PubMed abstract 1065904 15  PubMed abstract 4030947 16  PubMed abstract 2266117 17  PubMed abstract 221818 18  PubMed abstract 6249166 19  PubMed abstract 6263630 20   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22  PubMed abstract 216007 23  PubMed abstract 7274457 24  PubMed abstract 13642798 25   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26  PubMed abstract 4344689 27   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29  PubMed abstract 13348631 30  PubMed abstract 1065904 31  PubMed abstract 4030947 32  PubMed abstract 2266117
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin gamma (Gamma-MSH)
Mature Hormone Sequence	YVMGHFRWDRF
Position of mature hormone in Pre-Hormone protein	11 Residues from position (77-87)
Receptor	P47798    Detail in HMRbase
Gene ID	281416
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 25

HMRbase accession number	11260
Swiss-prot Accession number	P01190 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	ACTH stimulates the adrenal glands to release cortisol
Protein Length	265 Amino acids
Molecular weight	29260
References	1  PubMed abstract 221818 2  PubMed abstract 6249166 3  PubMed abstract 6263630 4   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6  PubMed abstract 216007 7  PubMed abstract 7274457 8  PubMed abstract 13642798 9   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10  PubMed abstract 4344689 11   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13  PubMed abstract 13348631 14  PubMed abstract 1065904 15  PubMed abstract 4030947 16  PubMed abstract 2266117 17  PubMed abstract 221818 18  PubMed abstract 6249166 19  PubMed abstract 6263630 20   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22  PubMed abstract 216007 23  PubMed abstract 7274457 24  PubMed abstract 13642798 25   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26  PubMed abstract 4344689 27   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29  PubMed abstract 13348631 30  PubMed abstract 1065904 31  PubMed abstract 4030947 32  PubMed abstract 2266117
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAQAFPLEF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (132-170)
Receptor	P47798    Detail in HMRbase
Gene ID	281416
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 26

HMRbase accession number	11261
Swiss-prot Accession number	P01190 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	265 Amino acids
Molecular weight	29260
References	1  PubMed abstract 221818 2  PubMed abstract 6249166 3  PubMed abstract 6263630 4   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6  PubMed abstract 216007 7  PubMed abstract 7274457 8  PubMed abstract 13642798 9   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10  PubMed abstract 4344689 11   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13  PubMed abstract 13348631 14  PubMed abstract 1065904 15  PubMed abstract 4030947 16  PubMed abstract 2266117 17  PubMed abstract 221818 18  PubMed abstract 6249166 19  PubMed abstract 6263630 20   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22  PubMed abstract 216007 23  PubMed abstract 7274457 24  PubMed abstract 13642798 25   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26  PubMed abstract 4344689 27   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29  PubMed abstract 13348631 30  PubMed abstract 1065904 31  PubMed abstract 4030947 32  PubMed abstract 2266117
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (132-144)
Receptor	P47798    Detail in HMRbase
Gene ID	281416
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 27

HMRbase accession number	11262
Swiss-prot Accession number	P01190 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	265 Amino acids
Molecular weight	29260
References	1  PubMed abstract 221818 2  PubMed abstract 6249166 3  PubMed abstract 6263630 4   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6  PubMed abstract 216007 7  PubMed abstract 7274457 8  PubMed abstract 13642798 9   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10  PubMed abstract 4344689 11   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13  PubMed abstract 13348631 14  PubMed abstract 1065904 15  PubMed abstract 4030947 16  PubMed abstract 2266117 17  PubMed abstract 221818 18  PubMed abstract 6249166 19  PubMed abstract 6263630 20   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22  PubMed abstract 216007 23  PubMed abstract 7274457 24  PubMed abstract 13642798 25   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26  PubMed abstract 4344689 27   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29  PubMed abstract 13348631 30  PubMed abstract 1065904 31  PubMed abstract 4030947 32  PubMed abstract 2266117
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELTGERLEQARGPEAQAESAAARAELEYGLVAEAEAEAAEKKDSGPYKMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	93 Residues from position (173-265)
Receptor	P47798    Detail in HMRbase
Gene ID	281416
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 28

HMRbase accession number	11263
Swiss-prot Accession number	P01190 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	265 Amino acids
Molecular weight	29260
References	1  PubMed abstract 221818 2  PubMed abstract 6249166 3  PubMed abstract 6263630 4   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6  PubMed abstract 216007 7  PubMed abstract 7274457 8  PubMed abstract 13642798 9   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10  PubMed abstract 4344689 11   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13  PubMed abstract 13348631 14  PubMed abstract 1065904 15  PubMed abstract 4030947 16  PubMed abstract 2266117 17  PubMed abstract 221818 18  PubMed abstract 6249166 19  PubMed abstract 6263630 20   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22  PubMed abstract 216007 23  PubMed abstract 7274457 24  PubMed abstract 13642798 25   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26  PubMed abstract 4344689 27   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29  PubMed abstract 13348631 30  PubMed abstract 1065904 31  PubMed abstract 4030947 32  PubMed abstract 2266117
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELTGERLEQARGPEAQAESAAARAELEYGLVAEAEAEAAEKKDSGPYKMEHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	60 Residues from position (173-232)
Receptor	P47798    Detail in HMRbase
Gene ID	281416
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 29

HMRbase accession number	11264
Swiss-prot Accession number	P01190 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	265 Amino acids
Molecular weight	29260
References	1  PubMed abstract 221818 2  PubMed abstract 6249166 3  PubMed abstract 6263630 4   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6  PubMed abstract 216007 7  PubMed abstract 7274457 8  PubMed abstract 13642798 9   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10  PubMed abstract 4344689 11   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13  PubMed abstract 13348631 14  PubMed abstract 1065904 15  PubMed abstract 4030947 16  PubMed abstract 2266117 17  PubMed abstract 221818 18  PubMed abstract 6249166 19  PubMed abstract 6263630 20   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22  PubMed abstract 216007 23  PubMed abstract 7274457 24  PubMed abstract 13642798 25   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26  PubMed abstract 4344689 27   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29  PubMed abstract 13348631 30  PubMed abstract 1065904 31  PubMed abstract 4030947 32  PubMed abstract 2266117
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	DSGPYKMEHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	18 Residues from position (215-232)
Receptor	P47798    Detail in HMRbase
Gene ID	281416
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 30

HMRbase accession number	11265
Swiss-prot Accession number	P01190 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Met-enkephalin is an endogenous opiate
Protein Length	265 Amino acids
Molecular weight	29260
References	1  PubMed abstract 221818 2  PubMed abstract 6249166 3  PubMed abstract 6263630 4   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6  PubMed abstract 216007 7  PubMed abstract 7274457 8  PubMed abstract 13642798 9   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10  PubMed abstract 4344689 11   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13  PubMed abstract 13348631 14  PubMed abstract 1065904 15  PubMed abstract 4030947 16  PubMed abstract 2266117 17  PubMed abstract 221818 18  PubMed abstract 6249166 19  PubMed abstract 6263630 20   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22  PubMed abstract 216007 23  PubMed abstract 7274457 24  PubMed abstract 13642798 25   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26  PubMed abstract 4344689 27   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29  PubMed abstract 13348631 30  PubMed abstract 1065904 31  PubMed abstract 4030947 32  PubMed abstract 2266117
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (235-239)
Receptor	P47798    Detail in HMRbase
Gene ID	281416
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 31

HMRbase accession number	11274
Swiss-prot Accession number	P01192 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	267 Amino acids
Molecular weight	28895
References	1  PubMed abstract 3753882 2  PubMed abstract 6196724 3  PubMed abstract 7958386 4  PubMed abstract 6547437 5   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6  PubMed abstract 4334191 7  PubMed abstract 4369114 8  PubMed abstract 2174774 9  PubMed abstract 13451616 10  PubMed abstract 5543613 11   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12  PubMed abstract 4673865 13  PubMed abstract 13348631 14   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15  PubMed abstract 1207728 16  PubMed abstract 1007884 17  PubMed abstract 3753882 18  PubMed abstract 6196724 19  PubMed abstract 7958386 20  PubMed abstract 6547437 21   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22  PubMed abstract 4334191 23  PubMed abstract 4369114 24  PubMed abstract 2174774 25  PubMed abstract 13451616 26  PubMed abstract 5543613 27   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28  PubMed abstract 4673865 29  PubMed abstract 13348631 30   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31  PubMed abstract 1207728 32  PubMed abstract 1007884
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin gamma (Gamma-MSH)
Mature Hormone Sequence	YVMGHFRWDRF
Position of mature hormone in Pre-Hormone protein	11 Residues from position (77-87)
Receptor	Q9TU05    Detail in HMRbase
Gene ID	396863
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 32

HMRbase accession number	11275
Swiss-prot Accession number	P01192 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	ACTH stimulates the adrenal glands to release cortisol
Protein Length	267 Amino acids
Molecular weight	28895
References	1  PubMed abstract 3753882 2  PubMed abstract 6196724 3  PubMed abstract 7958386 4  PubMed abstract 6547437 5   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6  PubMed abstract 4334191 7  PubMed abstract 4369114 8  PubMed abstract 2174774 9  PubMed abstract 13451616 10  PubMed abstract 5543613 11   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12  PubMed abstract 4673865 13  PubMed abstract 13348631 14   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15  PubMed abstract 1207728 16  PubMed abstract 1007884 17  PubMed abstract 3753882 18  PubMed abstract 6196724 19  PubMed abstract 7958386 20  PubMed abstract 6547437 21   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22  PubMed abstract 4334191 23  PubMed abstract 4369114 24  PubMed abstract 2174774 25  PubMed abstract 13451616 26  PubMed abstract 5543613 27   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28  PubMed abstract 4673865 29  PubMed abstract 13348631 30   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31  PubMed abstract 1207728 32  PubMed abstract 1007884
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDELAEAFPLEF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (136-174)
Receptor	Q9TU05    Detail in HMRbase
Gene ID	396863
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 33

HMRbase accession number	11276
Swiss-prot Accession number	P01192 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	267 Amino acids
Molecular weight	28895
References	1  PubMed abstract 3753882 2  PubMed abstract 6196724 3  PubMed abstract 7958386 4  PubMed abstract 6547437 5   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6  PubMed abstract 4334191 7  PubMed abstract 4369114 8  PubMed abstract 2174774 9  PubMed abstract 13451616 10  PubMed abstract 5543613 11   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12  PubMed abstract 4673865 13  PubMed abstract 13348631 14   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15  PubMed abstract 1207728 16  PubMed abstract 1007884 17  PubMed abstract 3753882 18  PubMed abstract 6196724 19  PubMed abstract 7958386 20  PubMed abstract 6547437 21   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22  PubMed abstract 4334191 23  PubMed abstract 4369114 24  PubMed abstract 2174774 25  PubMed abstract 13451616 26  PubMed abstract 5543613 27   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28  PubMed abstract 4673865 29  PubMed abstract 13348631 30   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31  PubMed abstract 1207728 32  PubMed abstract 1007884
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (136-148)
Receptor	Q9TU05    Detail in HMRbase
Gene ID	396863
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 34

HMRbase accession number	11277
Swiss-prot Accession number	P01192 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	267 Amino acids
Molecular weight	28895
References	1  PubMed abstract 3753882 2  PubMed abstract 6196724 3  PubMed abstract 7958386 4  PubMed abstract 6547437 5   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6  PubMed abstract 4334191 7  PubMed abstract 4369114 8  PubMed abstract 2174774 9  PubMed abstract 13451616 10  PubMed abstract 5543613 11   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12  PubMed abstract 4673865 13  PubMed abstract 13348631 14   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15  PubMed abstract 1207728 16  PubMed abstract 1007884 17  PubMed abstract 3753882 18  PubMed abstract 6196724 19  PubMed abstract 7958386 20  PubMed abstract 6547437 21   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22  PubMed abstract 4334191 23  PubMed abstract 4369114 24  PubMed abstract 2174774 25  PubMed abstract 13451616 26  PubMed abstract 5543613 27   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28  PubMed abstract 4673865 29  PubMed abstract 13348631 30   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31  PubMed abstract 1207728 32  PubMed abstract 1007884
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELAGAPPEPARDPEAPAEGAAARAELEYGLVAEAEAAEKKDEGPYKMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	91 Residues from position (177-267)
Receptor	Q9TU05    Detail in HMRbase
Gene ID	396863
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 35

HMRbase accession number	11278
Swiss-prot Accession number	P01192 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	267 Amino acids
Molecular weight	28895
References	1  PubMed abstract 3753882 2  PubMed abstract 6196724 3  PubMed abstract 7958386 4  PubMed abstract 6547437 5   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6  PubMed abstract 4334191 7  PubMed abstract 4369114 8  PubMed abstract 2174774 9  PubMed abstract 13451616 10  PubMed abstract 5543613 11   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12  PubMed abstract 4673865 13  PubMed abstract 13348631 14   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15  PubMed abstract 1207728 16  PubMed abstract 1007884 17  PubMed abstract 3753882 18  PubMed abstract 6196724 19  PubMed abstract 7958386 20  PubMed abstract 6547437 21   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22  PubMed abstract 4334191 23  PubMed abstract 4369114 24  PubMed abstract 2174774 25  PubMed abstract 13451616 26  PubMed abstract 5543613 27   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28  PubMed abstract 4673865 29  PubMed abstract 13348631 30   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31  PubMed abstract 1207728 32  PubMed abstract 1007884
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELAGAPPEPARDPEAPAEGAAARAELEYGLVAEAEAAEKKDEGPYKMEHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	58 Residues from position (177-234)
Receptor	Q9TU05    Detail in HMRbase
Gene ID	396863
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 36

HMRbase accession number	11279
Swiss-prot Accession number	P01192 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	267 Amino acids
Molecular weight	28895
References	1  PubMed abstract 3753882 2  PubMed abstract 6196724 3  PubMed abstract 7958386 4  PubMed abstract 6547437 5   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6  PubMed abstract 4334191 7  PubMed abstract 4369114 8  PubMed abstract 2174774 9  PubMed abstract 13451616 10  PubMed abstract 5543613 11   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12  PubMed abstract 4673865 13  PubMed abstract 13348631 14   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15  PubMed abstract 1207728 16  PubMed abstract 1007884 17  PubMed abstract 3753882 18  PubMed abstract 6196724 19  PubMed abstract 7958386 20  PubMed abstract 6547437 21   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22  PubMed abstract 4334191 23  PubMed abstract 4369114 24  PubMed abstract 2174774 25  PubMed abstract 13451616 26  PubMed abstract 5543613 27   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28  PubMed abstract 4673865 29  PubMed abstract 13348631 30   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31  PubMed abstract 1207728 32  PubMed abstract 1007884
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	DEGPYKMEHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	18 Residues from position (217-234)
Receptor	Q9TU05    Detail in HMRbase
Gene ID	396863
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 37

HMRbase accession number	11280
Swiss-prot Accession number	P01192 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Beta-endorphin is an endogenous opiate
Protein Length	267 Amino acids
Molecular weight	28895
References	1  PubMed abstract 3753882 2  PubMed abstract 6196724 3  PubMed abstract 7958386 4  PubMed abstract 6547437 5   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6  PubMed abstract 4334191 7  PubMed abstract 4369114 8  PubMed abstract 2174774 9  PubMed abstract 13451616 10  PubMed abstract 5543613 11   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12  PubMed abstract 4673865 13  PubMed abstract 13348631 14   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15  PubMed abstract 1207728 16  PubMed abstract 1007884 17  PubMed abstract 3753882 18  PubMed abstract 6196724 19  PubMed abstract 7958386 20  PubMed abstract 6547437 21   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22  PubMed abstract 4334191 23  PubMed abstract 4369114 24  PubMed abstract 2174774 25  PubMed abstract 13451616 26  PubMed abstract 5543613 27   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28  PubMed abstract 4673865 29  PubMed abstract 13348631 30   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31  PubMed abstract 1207728 32  PubMed abstract 1007884
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	31 Residues from position (237-267)
Receptor	Q9TU05    Detail in HMRbase
Gene ID	396863
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 38

HMRbase accession number	11281
Swiss-prot Accession number	P01192 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Met-enkephalin is an endogenous opiate
Protein Length	267 Amino acids
Molecular weight	28895
References	1  PubMed abstract 3753882 2  PubMed abstract 6196724 3  PubMed abstract 7958386 4  PubMed abstract 6547437 5   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 6  PubMed abstract 4334191 7  PubMed abstract 4369114 8  PubMed abstract 2174774 9  PubMed abstract 13451616 10  PubMed abstract 5543613 11   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 12  PubMed abstract 4673865 13  PubMed abstract 13348631 14   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 15  PubMed abstract 1207728 16  PubMed abstract 1007884 17  PubMed abstract 3753882 18  PubMed abstract 6196724 19  PubMed abstract 7958386 20  PubMed abstract 6547437 21   Shepherd R.G., Willson S.D., Howard K.S., Bell P.H., Davies D.S.,Davis S.B., Eigner E.A., Shakespeare N.E.; "Studies with corticotropin. III. Determination of the structure ofbeta-corticotropin and its active degradation products."; J. Am. Chem. Soc. 78:5067-5076(1956). 22  PubMed abstract 4334191 23  PubMed abstract 4369114 24  PubMed abstract 2174774 25  PubMed abstract 13451616 26  PubMed abstract 5543613 27   Gilardeau C., Chretien M.; "Complete amino acid sequence of porcine beta-lipotropic hormone(beta-LPH)."; (In) Meienhofer J. (eds.);Chemistry and biology of peptides, pp.609-611, Ann Arbor Sci. Pub.,Ann Arbor (1972). 28  PubMed abstract 4673865 29  PubMed abstract 13348631 30   Geschwind I.I., Li C.H., Barnafi L.; "The structure of the beta-melanocyte-stimulating hormone."; J. Am. Chem. Soc. 79:620-625(1957). 31  PubMed abstract 1207728 32  PubMed abstract 1007884
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (237-241)
Receptor	Q9TU05    Detail in HMRbase
Gene ID	396863
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 39

HMRbase accession number	11291
Swiss-prot Accession number	P01201 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Macaca nemestrina (Pig-tailed macaque)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	264 Amino acids
Molecular weight	29172
References	1  PubMed abstract 3229286 2  PubMed abstract 13760276 3  PubMed abstract 3229286 4  PubMed abstract 13760276
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin gamma (Gamma-MSH)
Mature Hormone Sequence	YVMGHFRWDRF
Position of mature hormone in Pre-Hormone protein	11 Residues from position (77-87)
Receptor	Q864J8    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 40

HMRbase accession number	11292
Swiss-prot Accession number	P01201 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Macaca nemestrina (Pig-tailed macaque)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	ACTH stimulates the adrenal glands to release cortisol
Protein Length	264 Amino acids
Molecular weight	29172
References	1  PubMed abstract 3229286 2  PubMed abstract 13760276 3  PubMed abstract 3229286 4  PubMed abstract 13760276
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (135-173)
Receptor	Q864J8    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 41

HMRbase accession number	11293
Swiss-prot Accession number	P01201 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Macaca nemestrina (Pig-tailed macaque)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	264 Amino acids
Molecular weight	29172
References	1  PubMed abstract 3229286 2  PubMed abstract 13760276 3  PubMed abstract 3229286 4  PubMed abstract 13760276
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (135-147)
Receptor	Q864J8    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 42

HMRbase accession number	11294
Swiss-prot Accession number	P01201 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Macaca nemestrina (Pig-tailed macaque)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	264 Amino acids
Molecular weight	29172
References	1  PubMed abstract 3229286 2  PubMed abstract 13760276 3  PubMed abstract 3229286 4  PubMed abstract 13760276
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELTGQRPRAGDGPDGPADDGAGPRADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGQ
Position of mature hormone in Pre-Hormone protein	89 Residues from position (176-264)
Receptor	Q864J8    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 43

HMRbase accession number	11295
Swiss-prot Accession number	P01201 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Macaca nemestrina (Pig-tailed macaque)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	264 Amino acids
Molecular weight	29172
References	1  PubMed abstract 3229286 2  PubMed abstract 13760276 3  PubMed abstract 3229286 4  PubMed abstract 13760276
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELTGQRPRAGDGPDGPADDGAGPRADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	56 Residues from position (176-231)
Receptor	Q864J8    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 44

HMRbase accession number	11296
Swiss-prot Accession number	P01201 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Macaca nemestrina (Pig-tailed macaque)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	264 Amino acids
Molecular weight	29172
References	1  PubMed abstract 3229286 2  PubMed abstract 13760276 3  PubMed abstract 3229286 4  PubMed abstract 13760276
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	DEGPYRMEHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	18 Residues from position (214-231)
Receptor	Q864J8    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 45

HMRbase accession number	11297
Swiss-prot Accession number	P01201 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Macaca nemestrina (Pig-tailed macaque)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Beta-endorphin is an endogenous opiate
Protein Length	264 Amino acids
Molecular weight	29172
References	1  PubMed abstract 3229286 2  PubMed abstract 13760276 3  PubMed abstract 3229286 4  PubMed abstract 13760276
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGQ
Position of mature hormone in Pre-Hormone protein	31 Residues from position (234-264)
Receptor	Q864J8    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 46

HMRbase accession number	11298
Swiss-prot Accession number	P01201 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Macaca nemestrina (Pig-tailed macaque)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Met-enkephalin is an endogenous opiate
Protein Length	264 Amino acids
Molecular weight	29172
References	1  PubMed abstract 3229286 2  PubMed abstract 13760276 3  PubMed abstract 3229286 4  PubMed abstract 13760276
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (234-238)
Receptor	Q864J8    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 47

HMRbase accession number	11416
Swiss-prot Accession number	P19402 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Cavia porcellus (Guinea pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	256 Amino acids
Molecular weight	28264
References	1  PubMed abstract 1662166 2  PubMed abstract 2830360 3  PubMed abstract 1662166 4  PubMed abstract 2830360
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin gamma (Gamma-MSH)
Mature Hormone Sequence	YVTGHFRWGRF
Position of mature hormone in Pre-Hormone protein	11 Residues from position (77-87)
Receptor	Q9Z1S9    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 48

HMRbase accession number	11417
Swiss-prot Accession number	P19402 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Cavia porcellus (Guinea pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	ACTH stimulates the adrenal glands to release cortisol
Protein Length	256 Amino acids
Molecular weight	28264
References	1  PubMed abstract 1662166 2  PubMed abstract 2830360 3  PubMed abstract 1662166 4  PubMed abstract 2830360
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGKKRRPVKVYANGAEEESAEAFPLEF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (125-163)
Receptor	Q9Z1S9    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 49

HMRbase accession number	11418
Swiss-prot Accession number	P19402 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Cavia porcellus (Guinea pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	256 Amino acids
Molecular weight	28264
References	1  PubMed abstract 1662166 2  PubMed abstract 2830360 3  PubMed abstract 1662166 4  PubMed abstract 2830360
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (125-137)
Receptor	Q9Z1S9    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 50

HMRbase accession number	11419
Swiss-prot Accession number	P19402 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Cavia porcellus (Guinea pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	256 Amino acids
Molecular weight	28264
References	1  PubMed abstract 1662166 2  PubMed abstract 2830360 3  PubMed abstract 1662166 4  PubMed abstract 2830360
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELTGERPAAAPGPDGLGFGLVAEAEAEAAAAEKKDAAEKKDDGSYRMEHFRWGTPRKGKRYGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	91 Residues from position (166-256)
Receptor	Q9Z1S9    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 51

HMRbase accession number	11420
Swiss-prot Accession number	P19402 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Cavia porcellus (Guinea pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	256 Amino acids
Molecular weight	28264
References	1  PubMed abstract 1662166 2  PubMed abstract 2830360 3  PubMed abstract 1662166 4  PubMed abstract 2830360
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELTGERPAAAPGPDGLGFGLVAEAEAEAAAAEKKDAAEKKDDGSYRMEHFRWGTPRKG
Position of mature hormone in Pre-Hormone protein	58 Residues from position (166-223)
Receptor	Q9Z1S9    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 52

HMRbase accession number	11421
Swiss-prot Accession number	P19402 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Cavia porcellus (Guinea pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Beta-endorphin is an endogenous opiate
Protein Length	256 Amino acids
Molecular weight	28264
References	1  PubMed abstract 1662166 2  PubMed abstract 2830360 3  PubMed abstract 1662166 4  PubMed abstract 2830360
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	31 Residues from position (226-256)
Receptor	Q9Z1S9    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 53

HMRbase accession number	11422
Swiss-prot Accession number	P19402 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Cavia porcellus (Guinea pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Met-enkephalin is an endogenous peptide
Protein Length	256 Amino acids
Molecular weight	28264
References	1  PubMed abstract 1662166 2  PubMed abstract 2830360 3  PubMed abstract 1662166 4  PubMed abstract 2830360
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (226-230)
Receptor	Q9Z1S9    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 54

HMRbase accession number	11501
Swiss-prot Accession number	Q04618 (Sequence in FASTA format)
Description	Corticotropin-lipotropin B precursor (Pro-opiomelanocortin B) (POMC B)[Contains: NPP 2; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 2 (Alpha-MSH 2); Corticotropin-like intermediarypeptide 2 (CLIP-2); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 2 (Beta-MSH 2); Beta-endorphin 2; Met-enkephalin].
Source organism	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	N/A
Developmental Stage	Expressed only in sexually active fish.
Similarity	Belongs to the POMC family.
Tissue Specificity	Pituitary and hypothalamus of adult diploid animals
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner.
Function	N/A
Protein Length	240 Amino acids
Molecular weight	26719
References	1  PubMed abstract 1448114 2  PubMed abstract 1448114
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (212-216)
Receptor	Q6QLQ0   Detail in HMRbase    Q6QLQ1    Detail in HMRbase
Gene ID	100136772
PDB ID	N/A
Drugpedia	wiki
Comments