A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10928
Swiss-prot Accession number	P21252 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Loxodonta africana (African elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	ACTH stimulates the adrenal glands to release cortisol
Protein Length	134 Amino acids
Molecular weight	14935
References	1  PubMed abstract 2854538 2  PubMed abstract 2854538
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEGESAEAFPLEF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (1-39)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10929
Swiss-prot Accession number	P21252 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Loxodonta africana (African elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	134 Amino acids
Molecular weight	14935
References	1  PubMed abstract 2854538 2  PubMed abstract 2854538
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (1-13)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10930
Swiss-prot Accession number	P21252 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Loxodonta africana (African elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	134 Amino acids
Molecular weight	14935
References	1  PubMed abstract 2854538 2  PubMed abstract 2854538
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELARERPEPARGPEGPDEGAATQADLDNGLVAEVEATSAEKKDEGPYKMEHFRWGSPAKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGH
Position of mature hormone in Pre-Hormone protein	93 Residues from position (42-134)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10931
Swiss-prot Accession number	P21252 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Loxodonta africana (African elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	134 Amino acids
Molecular weight	14935
References	1  PubMed abstract 2854538 2  PubMed abstract 2854538
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELARERPEPARGPEGPDEGAATQADLDNGLVAEVEATSAEKKDEGPYKMEHFRWGSPAKD
Position of mature hormone in Pre-Hormone protein	60 Residues from position (42-101)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10932
Swiss-prot Accession number	P21252 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Loxodonta africana (African elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	134 Amino acids
Molecular weight	14935
References	1  PubMed abstract 2854538 2  PubMed abstract 2854538
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	DEGPYKMEHFRWGSPAKD
Position of mature hormone in Pre-Hormone protein	18 Residues from position (84-101)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10933
Swiss-prot Accession number	P21252 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Loxodonta africana (African elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Beta-endorphin is an endogenous opiate
Protein Length	134 Amino acids
Molecular weight	14935
References	1  PubMed abstract 2854538 2  PubMed abstract 2854538
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGH
Position of mature hormone in Pre-Hormone protein	31 Residues from position (104-134)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10934
Swiss-prot Accession number	P21252 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Loxodonta africana (African elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Met-enkephalin is an endogenous peptide
Protein Length	134 Amino acids
Molecular weight	14935
References	1  PubMed abstract 2854538 2  PubMed abstract 2854538
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (104-108)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	10935
Swiss-prot Accession number	P11280 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Mustela vison (American mink) (Neovison vison)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	ACTH stimulates the adrenal glands to release cortisol
Protein Length	142 Amino acids
Molecular weight	15822
References	1  PubMed abstract 3397057 2  PubMed abstract 3382437 3  PubMed abstract 3397057 4  PubMed abstract 3382437
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (11-49)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	10936
Swiss-prot Accession number	P11280 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Mustela vison (American mink) (Neovison vison)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	142 Amino acids
Molecular weight	15822
References	1  PubMed abstract 3397057 2  PubMed abstract 3382437 3  PubMed abstract 3397057 4  PubMed abstract 3382437
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (11-23)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	10937
Swiss-prot Accession number	P11280 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Mustela vison (American mink) (Neovison vison)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	142 Amino acids
Molecular weight	15822
References	1  PubMed abstract 3397057 2  PubMed abstract 3382437 3  PubMed abstract 3397057 4  PubMed abstract 3382437
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELAGERPEPALGPEGAAEGMAALADLEYGLVAKAEVAEKKDDGPYKMEHFRWGSPGKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	91 Residues from position (52-142)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	10938
Swiss-prot Accession number	P11280 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Mustela vison (American mink) (Neovison vison)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	142 Amino acids
Molecular weight	15822
References	1  PubMed abstract 3397057 2  PubMed abstract 3382437 3  PubMed abstract 3397057 4  PubMed abstract 3382437
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELAGERPEPALGPEGAAEGMAALADLEYGLVAKAEVAEKKDDGPYKMEHFRWGSPGKD
Position of mature hormone in Pre-Hormone protein	58 Residues from position (52-109)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	10939
Swiss-prot Accession number	P11280 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Mustela vison (American mink) (Neovison vison)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	142 Amino acids
Molecular weight	15822
References	1  PubMed abstract 3397057 2  PubMed abstract 3382437 3  PubMed abstract 3397057 4  PubMed abstract 3382437
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	DDGPYKMEHFRWGSPGKD
Position of mature hormone in Pre-Hormone protein	18 Residues from position (92-109)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	10940
Swiss-prot Accession number	P11280 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Mustela vison (American mink) (Neovison vison)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Beta-endorphin is an endogenous peptide
Protein Length	142 Amino acids
Molecular weight	15822
References	1  PubMed abstract 3397057 2  PubMed abstract 3382437 3  PubMed abstract 3397057 4  PubMed abstract 3382437
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	31 Residues from position (112-142)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 14

HMRbase accession number	10941
Swiss-prot Accession number	P11280 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Mustela vison (American mink) (Neovison vison)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Met-enkephalin is an endogenous peptide
Protein Length	142 Amino acids
Molecular weight	15822
References	1  PubMed abstract 3397057 2  PubMed abstract 3382437 3  PubMed abstract 3397057 4  PubMed abstract 3382437
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (112-116)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 15

HMRbase accession number	11266
Swiss-prot Accession number	P01191 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	212 Amino acids
Molecular weight	23464
References	1  PubMed abstract 8384993 2   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3  PubMed abstract 4344689 4  PubMed abstract 4370084 5  PubMed abstract 13929167 6  PubMed abstract 4162144 7  PubMed abstract 4675453 8  PubMed abstract 4270658 9  PubMed abstract 843377 10  PubMed abstract 8384993 11   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12  PubMed abstract 4344689 13  PubMed abstract 4370084 14  PubMed abstract 13929167 15  PubMed abstract 4162144 16  PubMed abstract 4675453 17  PubMed abstract 4270658 18  PubMed abstract 843377
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin gamma (Gamma-MSH)
Mature Hormone Sequence	YVMGHFRWDRF
Position of mature hormone in Pre-Hormone protein	11 Residues from position (26-36)
Receptor	Q9TU77   Detail in HMRbase    O19037    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 16

HMRbase accession number	11267
Swiss-prot Accession number	P01191 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	ACTH stimulates the adrenal glands to release cortisol
Protein Length	212 Amino acids
Molecular weight	23464
References	1  PubMed abstract 8384993 2   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3  PubMed abstract 4344689 4  PubMed abstract 4370084 5  PubMed abstract 13929167 6  PubMed abstract 4162144 7  PubMed abstract 4675453 8  PubMed abstract 4270658 9  PubMed abstract 843377 10  PubMed abstract 8384993 11   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12  PubMed abstract 4344689 13  PubMed abstract 4370084 14  PubMed abstract 13929167 15  PubMed abstract 4162144 16  PubMed abstract 4675453 17  PubMed abstract 4270658 18  PubMed abstract 843377
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAQAFPLEF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (81-119)
Receptor	Q9TU77   Detail in HMRbase    O19037    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 17

HMRbase accession number	11268
Swiss-prot Accession number	P01191 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	212 Amino acids
Molecular weight	23464
References	1  PubMed abstract 8384993 2   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3  PubMed abstract 4344689 4  PubMed abstract 4370084 5  PubMed abstract 13929167 6  PubMed abstract 4162144 7  PubMed abstract 4675453 8  PubMed abstract 4270658 9  PubMed abstract 843377 10  PubMed abstract 8384993 11   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12  PubMed abstract 4344689 13  PubMed abstract 4370084 14  PubMed abstract 13929167 15  PubMed abstract 4162144 16  PubMed abstract 4675453 17  PubMed abstract 4270658 18  PubMed abstract 843377
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (81-93)
Receptor	Q9TU77   Detail in HMRbase    O19037    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 18

HMRbase accession number	11269
Swiss-prot Accession number	P01191 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	212 Amino acids
Molecular weight	23464
References	1  PubMed abstract 8384993 2   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3  PubMed abstract 4344689 4  PubMed abstract 4370084 5  PubMed abstract 13929167 6  PubMed abstract 4162144 7  PubMed abstract 4675453 8  PubMed abstract 4270658 9  PubMed abstract 843377 10  PubMed abstract 8384993 11   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12  PubMed abstract 4344689 13  PubMed abstract 4370084 14  PubMed abstract 13929167 15  PubMed abstract 4162144 16  PubMed abstract 4675453 17  PubMed abstract 4270658 18  PubMed abstract 843377
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELTGERLEQARGPEAQAESAAARAELEYGLVAEAEAAEKKDSGPYKMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKK
Position of mature hormone in Pre-Hormone protein	91 Residues from position (122-212)
Receptor	Q9TU77   Detail in HMRbase    O19037    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 19

HMRbase accession number	11270
Swiss-prot Accession number	P01191 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	212 Amino acids
Molecular weight	23464
References	1  PubMed abstract 8384993 2   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3  PubMed abstract 4344689 4  PubMed abstract 4370084 5  PubMed abstract 13929167 6  PubMed abstract 4162144 7  PubMed abstract 4675453 8  PubMed abstract 4270658 9  PubMed abstract 843377 10  PubMed abstract 8384993 11   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12  PubMed abstract 4344689 13  PubMed abstract 4370084 14  PubMed abstract 13929167 15  PubMed abstract 4162144 16  PubMed abstract 4675453 17  PubMed abstract 4270658 18  PubMed abstract 843377
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELTGERLEQARGPEAQAESAAARAELEYGLVAEAEAAEKKDSGPYKMEHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	58 Residues from position (122-179)
Receptor	Q9TU77   Detail in HMRbase    O19037    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 20

HMRbase accession number	11271
Swiss-prot Accession number	P01191 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	212 Amino acids
Molecular weight	23464
References	1  PubMed abstract 8384993 2   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3  PubMed abstract 4344689 4  PubMed abstract 4370084 5  PubMed abstract 13929167 6  PubMed abstract 4162144 7  PubMed abstract 4675453 8  PubMed abstract 4270658 9  PubMed abstract 843377 10  PubMed abstract 8384993 11   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12  PubMed abstract 4344689 13  PubMed abstract 4370084 14  PubMed abstract 13929167 15  PubMed abstract 4162144 16  PubMed abstract 4675453 17  PubMed abstract 4270658 18  PubMed abstract 843377
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	DSGPYKMEHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	18 Residues from position (162-179)
Receptor	Q9TU77   Detail in HMRbase    O19037    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 21

HMRbase accession number	11272
Swiss-prot Accession number	P01191 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Beta-endorphin is an endogenous opiate
Protein Length	212 Amino acids
Molecular weight	23464
References	1  PubMed abstract 8384993 2   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3  PubMed abstract 4344689 4  PubMed abstract 4370084 5  PubMed abstract 13929167 6  PubMed abstract 4162144 7  PubMed abstract 4675453 8  PubMed abstract 4270658 9  PubMed abstract 843377 10  PubMed abstract 8384993 11   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12  PubMed abstract 4344689 13  PubMed abstract 4370084 14  PubMed abstract 13929167 15  PubMed abstract 4162144 16  PubMed abstract 4675453 17  PubMed abstract 4270658 18  PubMed abstract 843377
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	31 Residues from position (182-212)
Receptor	Q9TU77   Detail in HMRbase    O19037    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 22

HMRbase accession number	11273
Swiss-prot Accession number	P01191 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Met-enkephalin is an endogenous opiate
Protein Length	212 Amino acids
Molecular weight	23464
References	1  PubMed abstract 8384993 2   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 3  PubMed abstract 4344689 4  PubMed abstract 4370084 5  PubMed abstract 13929167 6  PubMed abstract 4162144 7  PubMed abstract 4675453 8  PubMed abstract 4270658 9  PubMed abstract 843377 10  PubMed abstract 8384993 11   Leonis J., Li C.H., Chung D.; "Corticotropins (ACTH). XV. The action of chymotrypsin on alpha-corticotropin."; J. Am. Chem. Soc. 81:419-423(1959). 12  PubMed abstract 4344689 13  PubMed abstract 4370084 14  PubMed abstract 13929167 15  PubMed abstract 4162144 16  PubMed abstract 4675453 17  PubMed abstract 4270658 18  PubMed abstract 843377
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (182-186)
Receptor	Q9TU77   Detail in HMRbase    O19037    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments